KEGG   Rattus norvegicus (rat): 60665
Entry
60665             CDS       T01003                                 

Gene name
Cxcl6
Definition
(RefSeq) C-X-C motif chemokine 5 precursor
  KO
K05506  C-X-C motif chemokine 5/6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno05133  Pertussis
rno05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    60665 (Cxcl6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    60665 (Cxcl6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    60665 (Cxcl6)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    60665 (Cxcl6)
   04062 Chemokine signaling pathway
    60665 (Cxcl6)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    60665 (Cxcl6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    60665 (Cxcl6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    60665 (Cxcl6)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Chemokines
   60665 (Cxcl6)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 60665
NCBI-ProteinID: NP_071550
RGD: 708540
Ensembl: ENSRNOG00000002843
UniProt: P97885
Position
14
AA seq 130 aa
MSFQLRSSARIPSRSCSSFTLLAFLLLFTLPQHRAQAAPFSAMVATELRCVCLTLAPRIN
PKMIANLEVIPAGPHCPKVEVIAKLKNQKDNVCLDPQAPLIKKVIQKILGSENKKTKRNA
LALVRSASTQ
NT seq 393 nt   +upstreamnt  +downstreamnt
atgagcttccagctccgcagctccgcccgcatccctagccggtcctgctcgtcattcacc
ctgctggcatttctgctgctgttcacactgccacagcatcgagctcaagctgctcctttc
tcggccatggttgcaacggagctacgctgtgtttgcttaaccttagctccaagaattaac
cccaaaatgatcgctaatttggaggtgatccctgcaggtccacattgccccaaggtggaa
gtcatagctaagttgaagaaccagaaggataatgtttgtcttgacccacaagctccgttg
ataaagaaagtcattcagaaaatattgggcagtgaaaataagaaaacaaagcggaatgca
cttgcactggtcagatcagccagtactcaataa

DBGET integrated database retrieval system