KEGG   Rattus norvegicus (rat): 60670
Entry
60670             CDS       T01003                                 

Gene name
Fut4, Fuct
Definition
(RefSeq) fucosyltransferase 4
  KO
K07632  galactoside alpha-1,3-fucosyltransferase 4 [EC:2.4.1.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00515  Mannose type O-glycan biosynthesis
rno00601  Glycosphingolipid biosynthesis - lacto and neolacto series
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    60670 (Fut4)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    60670 (Fut4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rno01003]
    60670 (Fut4)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     60670 (Fut4)
Glycosyltransferases [BR:rno01003]
 Glycan extension
  Lewis blood group
   60670 (Fut4)
SSDB
Motif
Pfam: Glyco_transf_10 Glyco_tran_10_N
Other DBs
NCBI-GeneID: 60670
NCBI-ProteinID: NP_071555
RGD: 619954
Ensembl: ENSRNOG00000009157
UniProt: G3V757
Position
8q12
AA seq 433 aa
MAPAGRKLQHESRCRPSRPVDAWRAAATTRGRCMGTPGARRRARRGGWGLPRTSSGLAAA
GLLCTALTACLCWGQLPPLPWASPAPQRPVSVLLWWEPFGGRGGHSKPPPDCSLRFNISG
CRLLTDRAAYGEAQAVLFHHRDLVKGPPDWPPPWGAQERTDEAPELRVFDDQEGAVMLAR
EALETTGSRPPGQRWVWMNFESPSHTPGLRGLAKDLFNWTLSYRTDSDIFVPYGFLYPRS
HPAEQPSGLGPPLARKRGLVAWVVSHWNERQARVRYYHQLRRHVSVDVFGRAGPGQPVPA
VGLLHTVARYKFYLAFENSQHVDYITEKLWRNAFLAGAVPVVLGPDRANYERFVPRGSFI
HVDDFPSAASLAAYLLFLDRNVAVYRRYFHWRRSYAVHITSFWDEPWCQTCRAVQTSGDQ
PKSIHNLADWFQR
NT seq 1302 nt   +upstreamnt  +downstreamnt
atggccccggccgggcgaaagctacagcatgagagccggtgccgcccctcacggcccgtg
gacgcgtggcgagccgcggcgaccactcgtgggcgctgcatggggaccccaggggcccgg
cgacgcgcacggcgcggaggctggggattaccccggacctcctctgggctggcagcagcg
ggactactatgcaccgcgttgactgcctgcctctgttggggacagctgccgccgctgccc
tgggcgtccccagccccgcaacgcccggtgagtgtgctgctctggtgggaaccctttggg
gggcgcggcggccactccaagcctccccccgattgcagcctgcgcttcaacatcagcggc
tgccgcttgctcaccgaccgcgcggcctacggggaggctcaagcagtgctgttccaccac
cgcgacctggtgaagggaccccccgactggcccccgccctggggcgcccaagaacgcacc
gatgaggctccggagctacgcgtgttcgacgaccaggagggagcggtgatgctagctaga
gaagccctggagaccacaggctctcgtcccccgggtcagcggtgggtgtggatgaacttc
gaatcaccctcccacactccagggctgcggggcttggctaaggacctcttcaattggaca
ctatcctaccggaccgattcggatatcttcgtgccctatggcttcctctatcccaggagc
catccagccgaacagccttcaggtctgggccccccgctggcccgcaagcggggactggtg
gcctgggttgtgagccactggaacgagcgccaggcacgggtccgttactaccatcagctg
aggcggcacgtgtctgtggacgtgtttggccgggcgggacccggacaaccagtgccagcc
gtcgggttgctgcacacggtggcccgctacaagttttacctggcgtttgagaactcacag
cacgtggattacatcactgagaagctgtggcggaatgccttcctggctggggccgtgcca
gtggtacttggtcccgatcgtgccaactatgagcgcttcgtgcctcgtggttccttcatc
catgtggatgatttccctagtgctgcctccctggctgcctacctgctctttctggaccga
aacgtggctgtctatcgccgctacttccactggcgtcggagctatgcggtgcacatcact
tctttctgggatgagccatggtgccagacatgcagggccgtccagacctctggggaccag
cccaagagtatccacaacttggcagactggttccagcgatga

DBGET integrated database retrieval system