KEGG   Rattus norvegicus (rat): 613220
Entry
613220            CDS       T01003                                 
Symbol
Defal1
Name
(RefSeq) defensin alpha-like protein 1 precursor
  KO
K05230  defensin, alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
rno05150  Staphylococcus aureus infection
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    613220 (Defal1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    613220 (Defal1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    613220 (Defal1)
SSDB
Motif
Pfam: Defensin_propep MF_alpha_N
Other DBs
NCBI-GeneID: 613220
NCBI-ProteinID: NP_001028245
RGD: 1561398
Ensembl: ENSRNOG00000029462
UniProt: Q4JEI2
Structure
Position
16:70371518..70372353
AA seq 87 aa
MKTLILLSALVLLALQVQADPIQEAEEETKTEEQPADEDQDVSVSFEGPEASAVQDLRVR
RTLQCSCRRVCRNTCSCIRLSRSTYAS
NT seq 264 nt   +upstreamnt  +downstreamnt
atgaagactcttatcctcctctctgctcttgtcctgctggccttgcaggtccaggctgat
cccattcaagaggcagaggaagagactaaaactgaggagcagccagcagatgaggaccag
gatgtgtctgtctcctttgaaggcccagaagcctctgctgttcaagatttacgcgtaaga
aggaccttgcagtgcagttgcagaagagtctgcagaaatacgtgtagctgcattcggcta
tcaaggtccacatatgcatcataa

DBGET integrated database retrieval system