KEGG   Rattus norvegicus (rat): 613224
Entry
613224            CDS       T01003                                 

Gene name
Defa8
Definition
(RefSeq) defensin alpha 8
  KO
K05230  defensin, alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04621  NOD-like receptor signaling pathway
rno05150  Staphylococcus aureus infection
rno05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    613224 (Defa8)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    613224 (Defa8)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    613224 (Defa8)
SSDB
Motif
Pfam: Defensin_propep Defensin_RK-1 Defensin_beta_2 MF_alpha_N
Other DBs
NCBI-GeneID: 613224
NCBI-ProteinID: NP_001028249
RGD: 1566065
Ensembl: ENSRNOG00000046075
UniProt: Q4JEI6
Position
16q12.5
AA seq 103 aa
MKTLVLLSALVLLAFQVQADHIQEAEEETKTEEQPADEDQDMSVSFEGPEASALQNLEIG
WPLKQCHCRKFCRPYEKAEGSCRPGLFIKRKICCIQQWTPGRT
NT seq 312 nt   +upstreamnt  +downstreamnt
atgaagactcttgtcctcctctctgcccttgtcctgctggcattccaggtccaggctgat
cacattcaagaggcagaagaagagactaaaactgaggagcagccagcagatgaggaccag
gatatgtctgtctcctttgaaggcccagaagcctctgctcttcaaaatttagagatagga
tggccattaaagcagtgccattgccgaaaattctgcagaccttatgaaaaggccgagggg
tcctgtcgtccaggtctatttataaaacgcaaaatctgctgcatacaacaatggacacca
gggaggacataa

DBGET integrated database retrieval system