KEGG   Rattus norvegicus (rat): 619385
Entry
619385            CDS       T01003                                 

Gene name
Ncoa4
Definition
(RefSeq) nuclear receptor coactivator 4
  KO
K09289  nuclear receptor coactivator 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04216  Ferroptosis
rno05200  Pathways in cancer
rno05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    619385 (Ncoa4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    619385 (Ncoa4)
  09162 Cancer: specific types
   05216 Thyroid cancer
    619385 (Ncoa4)
SSDB
Motif
Pfam: ARA70
Other DBs
NCBI-GeneID: 619385
NCBI-ProteinID: NP_001029179
RGD: 1563014
Ensembl: ENSRNOG00000019768
UniProt: B1H215
Position
16p16
AA seq 622 aa
MNTSLEQSGCCSSRETLLRCSDARRELELAIGGVLRAEQQMKDNLREVKAQIHSCISRHL
ECLRSREVWLNEQVDLIYQLKEETLQQQAQQLYWLMGQFNCLIHQLEITQNKDLANQVAL
CLERLGSLTLKPEDSTVLLFEADASALRQTITTFGSLKTIQIPEHLMAHPSSSSVRPFLE
KRGYTQVPEQKSASSGTAVSLSEWLLVSKPAIGPQAPYVPSTNPQDWLTPKQTLENSQTS
ARICSDAWGNLKGLENWLLNSHQQEIPGKPSSSKCNSHCSTSSFSTEDEKVEDVEVLDQD
ELDLSDWLVTPQEPRDLEKPVNGRSDTSDKFKLLFQVFREPYNVNDWLVKPDSCTNCQGN
QPRGVEIENLGNLKCLNDHLEAKKSLPVPGVITEGWLVQNHQDTCKVEEVCKANEPCTSF
AECVCDDSCEKEAMHKWLLKKEGKDKNGMPMGPKSESEKHRESLSLWLCPSRNELTEHAK
TPKTTAPARIADSFHIIRNSSLSEWLIGPTCKGGGPKEVPNMEERASKEMLKSPMATYWR
PFNTADWVLPGKKVGNLSQFSSGEDKWLLRKKAQEVFLNSPLQEERNFRSDCYGLPAVCD
LFACMQLKVDKDKWLYRAPLQM
NT seq 1869 nt   +upstreamnt  +downstreamnt
atgaatacatccctggagcagagtggctgctgcagtagtagagagacacttctgaggtgc
agtgatgcaaggagggagctggagcttgcgattggtggagtcctccgggccgagcagcaa
atgaaagataatctacgagaggtgaaagctcagattcacagctgcattagtcgccacctg
gaatgccttcgaagccgagaggtgtggctcaacgagcaggtggatctcatctatcagctg
aaggaggagacgctgcagcagcaggctcagcagctgtactggctaatgggccaattcaat
tgtcttattcatcaactggagattacccagaacaaggatcttgccaatcaagtcgcgctg
tgcttggagagactgggcagtttgacccttaagcctgaggattctactgtcctgctcttt
gaagcagatgcatctgccctgcgtcagaccatcaccacgtttgggtccctcaagaccatt
caaattcctgagcacctgatggctcatcctagttcttcaagtgtcaggcctttcctggag
aaaagaggttatacccaggtgccagagcagaagtcagcatccagcggcacagctgtttct
ctcagtgaatggcttcttgtaagcaaacctgccattggtcctcaggctccatacgtaccc
agtaccaacccacaggactggctcaccccaaaacagaccttggagaacagtcagacttct
gccagaatctgcagcgatgcctggggcaatctgaagggcttagaaaactggctccttaac
agtcatcaacaagaaattcctggaaaaccaagttcctcaaaatgtaatagccattgtagc
accagttctttctctactgaagatgaaaaggttgaagatgtagaggtcctcgatcaagac
gagctggacctgtctgattggttggtgactcctcaggaaccccgtgatctggagaagcct
gtgaatggccgctctgacaccagtgacaagtttaagctcttgttccaggtgttcagagag
ccctacaatgtgaatgattggcttgtcaagcctgactcctgtaccaactgtcagggtaac
cagcccagaggtgtggagattgagaacctgggcaatctgaaatgcctgaatgaccacttg
gaggctaaaaagtcattgccagtccccggcgtaatcaccgagggctggcttgtccagaac
catcaggacacatgtaaagtagaggaagtctgcaaagccaacgagccctgcaccagcttt
gcagagtgtgtgtgtgatgacagctgtgagaaggaagcgatgcataaatggcttctgaag
aaagaagggaaggacaagaatggaatgcctatgggacccaaatctgagtctgagaaacac
agagagtccctgtctctgtggctttgcccttctagaaatgagctaacagaacacgctaag
acacccaagactacggctcctgctagaattgctgactccttccacatcataaggaatagc
tccttgtcagagtggcttattgggcctacatgcaaaggaggaggccccaaggaagtgccc
aatatggaggagagagctagcaaagaaatgcttaaaagccccatggccacttactggcgt
ccttttaacactgctgactgggtcttaccaggaaagaaagtgggaaaccttagtcagttc
tcctcgggagaagataagtggctacttcgaaagaaggcacaggaagtatttcttaattca
cccctacaagaagaacgtaactttcgctcagattgttacggcctcccggcagtttgtgat
ctctttgcctgtatgcagcttaaagttgataaggacaaatggctgtacagagcccctctt
cagatgtga

DBGET integrated database retrieval system