KEGG   Rattus norvegicus (rat): 619566
Entry
619566            CDS       T01003                                 

Gene name
Cdca7l
Definition
(RefSeq) cell division cycle-associated 7-like protein
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: zf-4CXXC_R1
Other DBs
NCBI-GeneID: 619566
NCBI-ProteinID: NP_001030125
RGD: 1564080
Ensembl: ENSRNOG00000005410
UniProt: Q4G059
Position
6
AA seq 438 aa
MELATRSQIPKEVADIFNAPSDDEEFVGFQDDVPMENLSESCGSLDSLELEKQNACLHSK
YFTEELRRIFKEDTDSDNEDFEGFTESELNIGSNPELIESELSDGDKTHPMMSDEEDDDD
EEEAAPRRGRQSTRSSFGLRVAFQFPTKKTAKTPDKNSPHLLGGKTDLRREKSCRQPKEK
EDSASDAEDESRAESQETSDALLKRAMNIKENKAMLAQLLAELNSVPDFFPVRTPPSASR
RRTPRRAFSEGQITRRVNPTRSARPPEKFALENFTFSATKLTEELYSFRRRKTISGGKCQ
KYRRHRISSFRSVKDITEEELENIAITVRDKVYDKVLGNTCHQCRQKTIDTKTVCRNQGC
GGVRGQFCGPCLRNRYGEDVRTALLDPKWTCPPCRGICNCSYCRRRDGRCATGILIHLAK
FYGYDNVKEYLESLQKQL
NT seq 1317 nt   +upstreamnt  +downstreamnt
atggagctggccacgcgctcccagatccccaaagaagtagctgacatcttcaatgccccc
agtgacgatgaagagtttgtgggtttccaggatgatgttcccatggaaaacctgtcagag
agctgtggtagtttggactcgctggagttggagaaacagaatgcgtgtttgcattccaaa
tacttcacagaagaacttagaaggattttcaaagaggacacagactcggacaatgaagat
ttcgaaggatttacggagagtgagctgaacataggcagtaacccagagctcatagagtca
gagctgagcgatggtgacaaaacacatcctatgatgagtgacgaggaggacgatgatgat
gaagaggaggctgcacctagaagaggccgccagtccacgagaagcagttttggcctccgg
gtagcctttcagttccccaccaaaaaaacggcaaaaacgccagataaaaatagcccgcac
ttgctgggcggcaagacggatcttagaagagagaagagctgcaggcagcccaaggaaaag
gaagactctgcttctgacgctgaggacgagtcgagggctgagagccaggagacttcagat
gctctgctgaaaagggccatgaacatcaaagagaacaaggccatgcttgctcagttgttg
gcggaattgaattcagtgccagatttcttccccgtgaggacgccaccctcagcttctagg
aggagaacacctcgacgggccttctcagagggacagatcacacggcgcgtgaacccaacc
cggagcgcacggcccccagaaaagtttgctctggaaaacttcaccttctcagccaccaag
cttaccgaagagctttacagtttcagaagaagaaagacaatcagtggggggaaatgccag
aagtatagaaggcaccggatatcttctttccgctcagtgaaagacatcaccgaggaagaa
ttggaaaatatcgccataactgtgcgagataaagtctatgataaagtgcttggtaacacg
tgccatcagtgccggcaaaagaccatcgacaccaagacagtctgtcggaaccagggctgt
ggcggtgtgcggggccagttctgtgggccgtgcctgcggaatcgctatggggaggatgtg
cggacagcattgctggatccgaagtggacatgtcctccctgccgtgggatctgcaattgc
agttactgccggagacgagatggccgctgtgccactgggattctcattcatctggccaag
ttctacggttatgataatgtcaaggagtacctggagagcttacagaagcagctgtag

DBGET integrated database retrieval system