KEGG   Rattus norvegicus (rat): 619574
Entry
619574            CDS       T01003                                 

Definition
(RefSeq) hypothetical protein LOC619574
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Cybc1_Eros Pep1_7
Other DBs
NCBI-GeneID: 619574
NCBI-ProteinID: NP_001030131
RGD: 1562022
Ensembl: ENSRNOG00000036666
UniProt: Q6AYA6
Position
10q32.3
AA seq 187 aa
MYMQVETRTSTRLHLKRAPGIRSWSLLVGILSTGLAAAYYSGDSLGWKLFYVTGCLFVAV
QNLEDWEEAIFNKSTGKVILKTFSLYKKLLTLLRAGHDQVVVLLKDIQDVNVEEEKVRYF
GKGYMVVLRFATGFSHPLTQSAVMGRRSDVEAIAKLITSFLELHRLESPSERSQSSDSEP
DGPGGQS
NT seq 564 nt   +upstreamnt  +downstreamnt
atgtatatgcaggtggaaacacgtaccagcacccgcctccatctgaagagggctcccggc
atccggtcttggtccctgctagttggaatattatccactggcctggctgctgcctattac
agtggagatagtctgggctggaagctcttctatgtcacaggctgcctctttgtggctgta
cagaacttggaggactgggaggaggccattttcaacaagagcactgggaaggtcatctta
aaaacattcagcctctacaagaagctgctgactcttctcagagcgggccatgatcaagtg
gtggtcctgttgaaagacatccaggatgtgaatgtggaggaggaaaaggtccgttacttt
gggaagggctacatggtggtgctccggtttgcaacaggcttctcccacccccttactcag
agtgcagtcatgggccgacgcagtgacgtggaagccattgccaaactcatcactagcttc
ttggagctgcaccgcctggagagcccctcagaacggtcacaaagcagtgacagtgaacct
gatggccctggtggccagagctga

DBGET integrated database retrieval system