KEGG   Rattus norvegicus (rat): 619580
Entry
619580            CDS       T01003                                 

Gene name
Ctps2
Definition
(RefSeq) CTP synthase 2
  KO
K01937  CTP synthase [EC:6.3.4.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00240  Pyrimidine metabolism
rno01100  Metabolic pathways
Module
rno_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    619580 (Ctps2)
Enzymes [BR:rno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.2  CTP synthase (glutamine hydrolysing)
     619580 (Ctps2)
SSDB
Motif
Pfam: CTP_synth_N GATase Peptidase_C26 CbiA
Other DBs
NCBI-GeneID: 619580
NCBI-ProteinID: NP_001030170
RGD: 1563369
Ensembl: ENSRNOG00000004257
UniProt: Q5U2N0
Position
Xq14
AA seq 586 aa
MKYILVTGGVISGIGKGIIASSIGTILKSCGLRVTAIKIDPYINIDAGTFSPYEHGEVFV
LNDGGEVDLDLGNYERFLDINLYKDNNITTGKIYQHVINKERRGDYLGKTVQVVPHITDA
IQDWVMNQAKVSVDGNKEDPQICVIELGGTIGDIEGMAFVEAFRQFQFKAKRENFYNIHV
SLVPQPSATGEQKTKPTQNSVRALRGLGLSPDLIVCRSSTPIEMAVKEKISMFCHVNPEQ
VICIHDVSSIYRVPLLLEEQGVVKYFQERLDLPINDCSNNLLFKWKTMADRYERLQKICS
IALVGKYTKLRDCYASVFKALEHSALAINHKLNLMYIDSIDLEPVTKAEDPVKFHEAWQK
LCLADGILVPGGFGIRGTLGKLQAISWARTKKIPFLGICLGMQLAVIEFARNCLNLKDAN
STEFDPNTPVPLVIDMPEHNPGDLGGTMRLGLRRTVFTTENSILKKLYGDVPYIEERHRH
RYEVNPNLINQFENKDLCFVGEDVDGKRMEIIELTGHPYFIGVQFHPEFSSRPMKPSPPY
LGLLLAATGTLNTHLQQMSKLSYSDIYSDASDDSFSEAKFAELDIN
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgaagtatatcctggttactggtggggtcatctcaggcattggtaaagggatcatcgcc
agcagcattgggaccattctcaagtcatgtggactccgagtaaccgccatcaagatcgac
ccctacattaacattgatgctggcactttctcaccttacgaacatggtgaagtatttgtt
ttaaatgatggtggagaagttgatttggaccttggaaattatgaaagattcttggacatt
aatctttataaagacaacaacatcaccactgggaagatatatcagcatgtgatcaacaaa
gagaggcgcggtgattatctggggaaaactgtccaagtggtcccccacattactgatgct
atccaagactgggttatgaatcaagccaaggtgtctgtggatggcaataaggaagatccc
cagatatgtgttatcgagctgggaggcaccattggagacatcgaagggatggcatttgtg
gaagcattccgacaattccagtttaaagcaaagagagagaatttctataatattcatgtc
agccttgtgccacagcccagtgctactggagaacaaaaaaccaagcctacacaaaacagt
gtccgtgcgctgagagggctgggcttgtctccggatctgattgtctgccgaagttcaaca
cccattgagatggctgtgaaggagaagatttctatgttttgtcacgtgaaccctgaacag
gtcatctgtatccatgatgtttcttccatctaccgagtccctcttcttttggaggagcaa
ggtgtggttaaatattttcaagagagattggacctgcccatcaatgattgctcaaataat
ttgcttttcaagtggaaaaccatggctgacaggtatgaaagattgcagaaaatatgttcc
atagccctggttggtaaatacaccaaactcagggactgctacgcctctgtgttcaaagcc
ctggaacactcagccttggccatcaaccacaagttgaatctgatgtacatagactccatt
gatctggagccagtcaccaaagctgaggatcctgtgaaattccatgaagcttggcagaag
ctgtgcttagctgatggtattctcgtgcctggaggctttggaatccgaggaacattggga
aaactccaggcaatttcttgggcaaggacaaagaagattccatttctgggaatttgcctt
gggatgcaactggcagtgattgagtttgcaagaaactgcctgaacttgaaagatgctaat
tctacagaatttgatccaaacactccagtcccattggtaattgacatgcctgaacacaac
cctggcgatttgggaggaacaatgagactgggattaagacgaactgttttcacaactgaa
aattccatactgaagaagctttacggtgatgttccttacatagaagaaagacaccgacat
cggtatgaggtgaaccctaacctgatcaaccaatttgagaataaagacctttgctttgtc
ggtgaggatgtggatgggaagaggatggagattattgaattgacaggtcatccatatttc
atcggcgtccaattccatcctgagttttcctctaggccaatgaagccttcccctccgtac
ctgggactcttacttgcagcaaccggaactctgaatacccatctgcaacagatgagcaaa
ctatcgtacagtgacatatacagtgatgccagtgatgatagcttttcagaggcgaagttt
gctgagctggatatcaactga

DBGET integrated database retrieval system