KEGG   Rattus norvegicus (rat): 63835Help
Entry
63835             CDS       T01003                                 

Gene name
Ctla4, CTLA-4, Cd152, sCTLA4
Definition
(RefSeq) cytotoxic T-lymphocyte-associated protein 4
  KO
K06538  cytotoxic T-lymphocyte-associated protein 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules (CAMs)
rno04660  T cell receptor signaling pathway
rno05320  Autoimmune thyroid disease
rno05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    63835 (Ctla4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    63835 (Ctla4)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    63835 (Ctla4)
   05320 Autoimmune thyroid disease
    63835 (Ctla4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    63835 (Ctla4)
CD molecules [BR:rno04090]
 Proteins
  63835 (Ctla4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set V-set_2 Ig_3 I-set
Motif
Other DBs
NCBI-GeneID: 63835
NCBI-ProteinID: NP_113862
RGD: 61975
Ensembl: ENSRNOG00000054129
Vega: OTTRNOG00000000097
UniProt: Q62859
Position
9q32
AA seq 223 aa AA seqDB search
MACLGLQRYKTHLQLPSRTWPFGVLLSLLFIPIFSEAIQVTQPSVVLASSHGVASFPCEY
ASSHNTDEVRVTVLRQTNDQVTEVCATTFTVKNTLGFLDDPFCSGTFNESRVNLTIQGLR
AADTGLYFCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFL
VTAVSLNRTLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggcttgtcttggactccagaggtacaaaactcacctgcagctgccttctaggacttgg
ccttttggagtcctgctttctcttctcttcatcccaatcttctctgaagccatacaagtg
acccaaccttcagtggtgttggccagcagccacggtgtcgccagctttccatgtgaatat
gcatcttcacacaacactgatgaggtccgggtgacggtgctgcggcagacaaatgaccaa
gtgacagaggtctgtgccacgacattcacagtgaagaacacgttgggcttcctagatgac
cccttctgcagtggtacctttaatgaaagcagagtgaacctcaccatccaaggactgagg
gctgctgacaccggactgtacttctgcaaggtggaactcatgtacccaccgccatacttt
gtgggcatgggcaacgggacccagatttatgtcatcgatccagaaccatgcccagattca
gacttcctcctttggatccttgctgcagttagttcggggttgtttttctacagtttcctg
gtcaccgctgtttctttgaacaggacgctaaagaaaagaagtcctcttacaacaggggtc
tatgtgaaaatgcccccaacagagccagaatgtgaaaagcaatttcaaccttattttatt
ccaatcaactga

DBGET integrated database retrieval system