KEGG   Rattus norvegicus (rat): 63836
Entry
63836             CDS       T01003                                 

Gene name
Actn4
Definition
(RefSeq) alpha-actinin-4
  KO
K05699  actinin alpha 1/4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04510  Focal adhesion
rno04520  Adherens junction
rno04530  Tight junction
rno04670  Leukocyte transendothelial migration
rno04810  Regulation of actin cytoskeleton
rno05146  Amoebiasis
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    63836 (Actn4)
   04520 Adherens junction
    63836 (Actn4)
   04530 Tight junction
    63836 (Actn4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    63836 (Actn4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    63836 (Actn4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    63836 (Actn4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    63836 (Actn4)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    63836 (Actn4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    63836 (Actn4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    63836 (Actn4)
   04147 Exosome [BR:rno04147]
    63836 (Actn4)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    63836 (Actn4)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     63836 (Actn4)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   63836 (Actn4)
  Exosomal proteins of colorectal cancer cells
   63836 (Actn4)
  Exosomal proteins of bladder cancer cells
   63836 (Actn4)
SSDB
Motif
Pfam: Spectrin CH EFhand_Ca_insen EF-hand_1 EF-hand_6 CAMSAP_CH EF-hand_7 EF-hand_8
Other DBs
NCBI-GeneID: 63836
NCBI-ProteinID: NP_113863
RGD: 61816
Ensembl: ENSRNOG00000020433
UniProt: Q9QXQ0
Position
1
AA seq 911 aa
MVDYHAANQAYQYGPSSGGNGTGGGGGMGDYMAQEDDWDRDLLLDPAWEKQQRKTFTAWC
NSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIA
SKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPY
KNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKM
LDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYER
LASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTL
QTKLRLSNRPAFMPSEGRMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQ
KASIHEAWTDGKEAMLKHRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQEL
NELDYYDSHNVNTRCQKICDQWDNLGSLTHSRREALEKTEKQLETIDQLHLEYAKRAAPF
NNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAES
NHIKLSGSNPYTSVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANM
VGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYKPNLDLLEQQHQLIQEALIF
DNKHTNYTMEHLRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKD
HGGALGPEEFKACLISLGYDVENDRQGDAEFNRIMSVVDPNHSGLVTFQAFIDFMSRETT
DTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAAPGALDYKS
FSTALYGESDL
NT seq 2736 nt   +upstreamnt  +downstreamnt
atggtggactatcacgcggcgaaccaggcgtaccagtacggcccaagcagcggcggcaat
ggcacgggcggcggcggaggcatgggcgactacatggcccaggaggatgactgggaccgg
gacctgctgttggacccggcctgggagaagcagcagcgcaagaccttcacagcctggtgc
aactcccatctgcggaaggctggcactcagatcgagaacatcgatgaggatttccgggat
gggctcaaacttatgcttctgctggaggtcatttcaggggagcggttgcctaagccagag
cgggggaagatgcgagtgcacaagatcaacaatgtaaacaaagccctggacttcatcgcc
agcaagggagtcaagctggtgtccattggggcagaagagatcgtggatggcaatgcaaag
atgaccctgggaatgatctggaccatcatcctcaggttcgccatccaagacatctctgtg
gaagagacctctgccaaggaaggactcctcctctggtgccagagaaagacagccccgtat
aaaaacgtcaacgtccagaacttccatatcagctggaaggatggtctggccttcaacgcg
ctcatccaccggcacagacctgagctgattgagtatgacaaactgaggaaggatgatcca
gtcaccaacctaaacaatgcatttgaagtggctgagaaataccttgatatccccaagatg
ttggatgctgaggacatcgtgaacacagcccggcccgacgagaaggccataatgacatat
gtgtccagcttctaccatgccttttcaggagcgcagaaggctgagactgctgccaaccgg
atctgcaaggtgctggctgtgaaccaggaaaatgagcacctgatggaagattacgagcgc
ctggccagtgatcttctagagtggatccggcgcaccatcccctggctggaagaccgtgtg
cctcagaagaccatccaggagatgcagcagaagctggaggacttccgagactataggcgt
gtgcacaagccccccaaggtacaggagaagtgtcagctggagatcaacttcaacaccctg
cagaccaagctgcggctgagcaaccggcctgccttcatgccctccgagggcaggatggtc
tcggacatcaacaatgggtggcaacatctggagcaggctgagaagggctatgaagaatgg
ctcttgaatgaaatccgtaggctggaacgacttgatcacctggcagagaaattccggcag
aaggcttccatccatgaggcctggaccgatgggaaggaggccatgctgaagcaccgggac
tatgagacagccaccctgtcagacatcaaagctctgatccgaaagcatgaggcctttgag
agtgacctggcggcgcaccaggaccgcgtggagcagatcgcggctattgcccaggagctc
aacgaactggactactatgactcccacaacgtcaacacacggtgccagaagatctgtgac
cagtgggataacctgggctctctgacccacagtcgcagggaagccttggagaaaacagag
aaacagctggagaccatcgaccagctacacttggagtatgctaagcgggccgcgcccttc
aacaactggatggagagtgccatggaggacctgcaggacatgttcatcgtccacaccatc
gaggagattgagggcctgatctcagcccacgaccagttcaagtccaccctgccagatgcc
gacagggagcgtgaggccatcctggccatccacaaagaggcccaaaggatcgctgagagc
aatcacatcaagctgtcgggcagcaacccctacaccagcgttacaccccagatcatcaac
tccaaatgggagaaggtgcagcagctggtgccgaagcgggaccacgcactcctggaagag
cagagcaagcagcaatccaatgagcaccttcgccgacagtttgccagccaagccaatatg
gtggggccctggatccagaccaagatggaggagattgggcgcatctccatcgagatgaac
gggactctggaagaccagctgagtcacttgaagcagtacgagcgcagcattgtggactac
aagcccaacctggacttgctggagcagcagcaccagctcatccaggaggccctcatcttc
gacaacaagcacaccaactacacaatggagcacctccgtgtgggctgggagcagctgctc
accaccattgcccgcaccatcaacgaggtagagaatcagatcctcacccgagatgccaag
ggcatcagccaggagcaaatgcaggagttccgagcctccttcaaccactttgacaaggac
catggcggggcactggggcctgaggaattcaaggcctgcctcatcagcctgggctacgac
gtggagaatgaccggcagggtgatgctgagttcaaccggatcatgagtgtggtcgacccc
aaccatagtggcctcgtgaccttccaagccttcattgacttcatgtcaagggagaccaca
gacacagacaccgccgatcaggtcatcgcctccttcaaggtcctggccggggacaagaac
ttcatcactgctgaggaacttcggagagagctgccccctgaccaggctgagtactgcatc
gcccgcatggcgccctaccagggccctgatgctgctccaggcgcccttgactacaagtcc
ttctctacagccctctatggggagagcgacctgtga

KEGG   Rattus norvegicus (rat): 81634
Entry
81634             CDS       T01003                                 

Gene name
Actn1
Definition
(RefSeq) alpha-actinin-1
  KO
K05699  actinin alpha 1/4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04510  Focal adhesion
rno04520  Adherens junction
rno04530  Tight junction
rno04670  Leukocyte transendothelial migration
rno04810  Regulation of actin cytoskeleton
rno05146  Amoebiasis
rno05203  Viral carcinogenesis
rno05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    81634 (Actn1)
   04520 Adherens junction
    81634 (Actn1)
   04530 Tight junction
    81634 (Actn1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    81634 (Actn1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    81634 (Actn1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    81634 (Actn1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    81634 (Actn1)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    81634 (Actn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    81634 (Actn1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    81634 (Actn1)
   04147 Exosome [BR:rno04147]
    81634 (Actn1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    81634 (Actn1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     81634 (Actn1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   81634 (Actn1)
  Exosomal proteins of colorectal cancer cells
   81634 (Actn1)
  Exosomal proteins of bladder cancer cells
   81634 (Actn1)
SSDB
Motif
Pfam: Spectrin CH EFhand_Ca_insen EF-hand_1 EF-hand_6 CAMSAP_CH EF-hand_7 EF-hand_8 EF-hand_5 XisI
Other DBs
NCBI-GeneID: 81634
NCBI-ProteinID: NP_112267
RGD: 70907
Ensembl: ENSRNOG00000056756
UniProt: Q9Z1P2
Position
6
AA seq 892 aa
MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFR
DGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNV
KMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFC
ALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAERYLDIPKMLDAEDIVGTARPDEKAIMT
YVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENR
VPENTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRM
VSDINNAWGCLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQK
DYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKIC
DQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHT
IEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEI
NGKWDHVRQLVPRRDQALTEEHSRQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIEM
HGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQL
LTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGY
DIGNDPQGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDK
NYITGDELRRELPPDQAEYCIARMAPYAGPDSVPGALDYMSFSTALYGESDL
NT seq 2679 nt   +upstreamnt  +downstreamnt
atggaccattatgattcccagcagaccaatgactatatgcagcctgaagaggactgggac
cgggacctgctcctggatccggcctgggagaagcagcagagaaagaccttcacggcctgg
tgcaactcccacctgcgcaaagcagggacccagattgagaacattgaagaggacttccga
gatggcctgaagctcatgctgctcctggaggtcatctcaggtgagcgtttggccaagcca
gagagaggcaagatgcgagtgcacaagatctccaacgtcaacaaggccctggatttcata
gccagcaaaggggtcaagctggtgtccattggagctgaagaaattgtggacgggaatgtg
aagatgaccctgggcatgatctggaccatcatccttcgttttgccatccaagacatctct
gtggaagagacatcagctaaagaagggttgctcctgtggtgtcagaggaagacagcccca
tataaaaatgtcaacatccaaaacttccacatcagttggaaggatggtcttggtttctgt
gccttgatccaccggcaccggcccgagttgattgactatggaaagcttcgaaaggatgat
ccactcacaaacctgaacacagcctttgatgtggcagagagatacctggacattccaaag
atgctggatgcagaagacatcgtcggaactgcccggccagatgagaaagccattatgacc
tatgtgtctagcttctaccatgccttctctggagcccagaaggcggaaacagcagccaat
cgaatctgtaaagtgttggccgtcaatcaagagaatgaacagcttatggaagactatgag
aagctggccagtgatctgttagagtggatccgccgcaccatcccatggctggagaatcgg
gtgcccgagaacaccatgcaggccatgcagcagaagctggaggacttccgagactaccga
cgcctgcacaagccgcccaaggtgcaggagaagtgccagctggagatcaacttcaacaca
ctgcagaccaagctgcggctaagcaaccggcctgccttcatgccctccgagggcaggatg
gtctcggatatcaacaatgcctggggctgcctggaacaggcagagaagggctacgaggag
tggttgctgaatgagatccggaggctagagaggttggaccacctggcagagaagttccgg
cagaaggcctccatccatgaagcctggacagacggcaaagaagccatgctgcggcagaag
gattatgagacggccaccttgtccgagatcaaggccctactcaagaagcacgaggccttt
gagagtgacctggctgcccaccaggaccgcgtggagcagatcgcggccattgcccaggag
cttaatgagctggactattatgactcaccaagtgtcaacgctcgatgccaaaagatctgt
gaccagtgggacaatctaggggccctgactcagaagcggagggaagctttagagcgaaca
gagaagctgctggagaccatcgaccagctatacttggagtacgccaagagggctgcaccc
ttcaacaactggatggagggagccatggaggaccttcaagacaccttcatcgtacatacc
attgaggagatccagggactgaccacagcccatgagcagttcaaggctaccctcccggat
gcagacaaggagcgcctggccatcctgggcatccacaatgaagtgtccaagattgtccag
acctatcatgtcaacatggcaggcaccaacccctatacaaccatcacacctcaggagatc
aatggcaaatgggaccatgtacggcagctggtgccccggagggaccaggctctaacagag
gagcactcgaggcagcagcacaacgagaggttacgcaagcagtttggggcacaagccaat
gtcatcggaccctggatccagaccaagatggaggagattgggaggatctccattgagatg
cacggtaccctggaggaccaactcagccacctgcggcagtatgaaaagagcatcgtcaat
tataagccaaagattgaccagctggagggcgaccaccagctcatccaggaagcacttatc
ttcgacaataagcacaccaactatacaatggagcacatccgtgtgggctgggagcagctg
ctcaccaccattgccaggaccatcaatgaagtggagaaccagatcttgacccgggatgcc
aaaggcatcagccaggaacagatgaacgaattccgagcctccttcaaccactttgaccgg
gatcactccggcacgttgggtcccgaagagttcaaagcctgcctcatcagcttgggttat
gatattggcaacgacccccagggagaggcagaatttgcccggatcatgagcattgtagac
ccaaaccgcttgggggtagtgacgttccaggccttcatcgacttcatgtcccgagagacg
gctgacacagatacagcggatcaggtcatggcttccttcaagatcctggctggagataag
aattacatcaccggggatgagctgcgccgcgagctgccacctgaccaagccgagtactgc
atcgcgagaatggccccctacgcgggccctgactccgtgccgggtgctctagactacatg
tccttctccacggcgctgtacggcgagagtgacctctaa

DBGET integrated database retrieval system