KEGG   Rattus norvegicus (rat): 63840Help
Entry
63840             CDS       T01003                                 

Gene name
Per2, rPER2
Definition
(RefSeq) period circadian clock 2
  KO
K02633  period circadian protein 2
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04710  Circadian rhythm
rno04713  Circadian entrainment
rno05202  Transcriptional misregulation in cancer
rno05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    63840 (Per2)
   04713 Circadian entrainment
    63840 (Per2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    63840 (Per2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    63840 (Per2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rno03400]
    63840 (Per2)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    63840 (Per2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Period_C PAS_3 PAS_11 PAS
Motif
Other DBs
NCBI-GeneID: 63840
NCBI-ProteinID: NP_113866
RGD: 61945
Ensembl: ENSRNOG00000020254
UniProt: Q9Z301
Position
9q36
AA seq 1257 aa AA seqDB search
MNGYVDFSPSPTSPTQEPGEPQPTQAVLQEDVDMSSGSSGNENCSTGRDSQGSDCDDSGK
ELRMLVESSNTHPSPDDTFRLMMTEAEHNPSTSGCSSEQSAKADAHKELIRTLRELKVHL
PADKKAKGKASTLATLKYALRSVKQVKANEEYYQLLMSSESQPCSVDVPSYTMEQVEGIT
SEYIVKNSDMFAVAVSLVSGKILYISNQVAPIFHCKKDAFSDAKFVEFLAPHDVSVFHSY
TTPYKLPPWSVSSGLDSFTQECMEEKSFFCRVSVGKHHENEIRYQPFRMTPYLVKVQEQK
GAASQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDVDERAVPLLGYLPQDLI
ETPVLVQLHPSDRPLMLAIHKKILQASGQPFDYSPIRFRTRNGEYITLDTSWSSFINPWS
RKISFIIGRHKVRVGPLNEDVFAASPCPEEKTPHPSVQELTEQIHRLLMQPVPHSGSSGY
GSLGSNGSHEHLMSQTSSSDSNGQEESHWRRSGIFKTSGKSQSKSHFSPESGGQKEASVA
EMQSSPPAQVRSVTTMERDSSGASLPKASFPEELTYKSQPPCSYQQISCLDSVIRYLESC
NEAATLKRKCEFPANIPSRKATVSPGLHSGEAARSSKVTSHTEVSAHLSSLALPGKAESV
VSLTSQCSYSSTIVHVGDKKPQPELETVEDVASGPESQDDAAGGLSQEKGSLQKLGLTKE
VLAAHTQREEQGFLQRFREVSRLGALQAHCQNYLQERSRAPASDRGLRNASGIESSWKKT
GKNRKLKSKRVKTRDSSESTGSGGPVSHRPPLVGLNATAWSPSDTSQSSCPSAPFPAPVP
AYPLPVFPAPGIVSTPGTVVAPPAAAHTGFTMPVVPMGTQPEFAVQPLPFAAPLAPVMAF
MLPSYPFPPATPNLPQAFFPSQPHFPAHPTLASEITPASQAEFPSRTSMLRQPCACPVTP
PAGTVALGRASPPLFQSRGSSPLQLNLLQLEEAPESSTGAAGTLGTTGTAASGLDCTSGA
SRDRQPKAPPTCSEPSDTQNSDAISTSSDLLNLLLGEDLCSATGSALSRSGASATSDSLG
SSSLGCDTSRSGAGSSDTSHTSKYFGSIDSSENNHKAKMITDTEESEQFIKYVLQDPIWL
LMANTDDNIMMTYQLPSRDLQAVLKEDQEKLKLLQRSQPHFTEGQRRELREVHPWVHTGG
LPTAIDVTGCVYCESEEKGNLCLPYEEDSPSLGLCDTSEAKEEESGQLANPRKEAQT
NT seq 3774 nt NT seq  +upstreamnt  +downstreamnt
atgaatggatatgtggacttttccccaagtcccaccagccccacccaagagccaggggag
cctcaacccacccaggctgtgctccaggaagacgtggacatgagcagcggctccagcgga
aatgaaaactgctccacggggcgggactctcagggcagtgactgtgacgacagtggaaag
gagctgcggatgttagtggaatcgtccaacactcaccccagccctgacgataccttcaga
ctcatgatgacagaggcggagcataacccctccacaagcggctgcagtagtgagcagtct
gccaaagctgacgcacacaaagagctgataaggaccctgagggagctgaaggtccacctc
cctgcagacaagaaggccaaggggaaggccagcacgctggcaaccttgaagtacgctctg
cggagcgtgaagcaggtgaaggctaatgaggagtactaccagctgctaatgtccagtgag
agccagccctgcagcgtggatgtgccttcctacaccatggagcaggttgagggcattacc
tccgagtatattgtgaagaactcggacatgtttgctgtggctgtgtccctggtctctggg
aagatcctgtacatctccaaccaagtcgcccccatctttcactgtaagaaggacgccttc
agtgatgccaagtttgtggagttcctggctccccatgacgtcagtgtgttccacagctac
accaccccttacaagcttccgccctggagtgtgagcagtggcttagattctttcactcag
gagtgcatggaggagaaatcttttttctgccgtgtcagtgttgggaaacaccacgagaat
gagattcgctaccagcccttccgcatgacaccctacctggtcaaggtgcaagagcagaag
ggcgctgcgagccagctctgctgcctgctgctagcagagagggtacactcaggctatgaa
gctcctagaattcctcccgagaagagaattttcacaacaacccacacaccaaactgcctg
ttccaggatgtggacgaaagggcggtccccctcctgggctatctacctcaggatctgatc
gagacccctgtgctcgtgcagctccaccccagcgaccggcccttgatgctcgccatccac
aagaagatcctacaggccagtgggcagcctttcgattattctcccattcgattccgcaca
cgcaacggggagtacatcacactggacactagctggtccagcttcatcaacccgtggagc
aggaagatatccttcatcatcgggaggcacaaagtcagggtaggccctttgaatgaggat
gtgttcgcagcctccccttgcccagaggagaagactccgcaccccagcgttcaggagctc
acagagcaaatccaccggctactgatgcaacctgtcccccacagcggctccagtggctat
gggagcctgggcagtaacggatcccacgaacacctcatgagccagacatcatccagcgac
agcaatggtcaagaggagtctcactggaggagatccggaatttttaaaaccagtggcaag
agtcaaagcaaaagtcacttttctcctgagtctggaggacaaaaggaagcctctgttgca
gaaatgcaaagtagtcctccagctcaggtgaggtctgtcaccaccatggaaagggacagc
tcgggggccagcctacccaaggctagctttccagaggaactaacctataagagccagcct
ccttgctcctaccagcagatcagctgcctggacagtgtcatcaggtacctggagagctgc
aacgaggcagccaccctgaaaagaaagtgcgagttcccagccaacatcccatcccggaag
gccacggtcagccctgggctgcactctggagaggcagcgcggtcctccaaggtgaccagc
cacacggaggtcagtgctcacttgagctccttggcgttgccgggcaaggccgagagtgtg
gtgtccctcaccagccagtgcagctacagcagcaccatcgtgcacgtgggcgacaaaaag
ccacagcctgaactagagacagtagaagatgtggccagtgggcctgagtcccaggatgat
gcagctggtggcctcagccaagaaaaggggtctctgcagaagctaggcctcaccaaggaa
gttctggctgcacatacccagagagaggaacagggcttcctgcagaggttcagggaagtg
agcaggctcggtgccctgcaggctcactgccagaactatctccaggagcggtcccgagcc
ccagcaagtgatcgaggactaagaaatgcttctggaatagaatcatcttggaaaaaaact
ggaaagaacaggaaactgaagtccaagcgtgtcaagactcgagactcttctgagagcaca
gggtctgggggacccgtgtcccaccgacctcccctcgtgggcctgaatgccacagcctgg
tcgccctctgacacatcccagtctagctgtccctctgcaccattccctgctccagtgcca
gcttacccactacctgtgttcccggcacctggaatagtatccacaccagggacggtggtg
gcaccacctgcagccgcccacaccggcttcaccatgcctgttgtgcctatgggcacccag
cctgaattcgcagtgcagcccctgccgttcgctgcccccttggctccggtcatggccttc
atgctacccagctacccgtttccaccagcaaccccaaacctgcctcaggccttcttcccc
agccagcctcactttccggcccatcccacacttgcctctgaaataactcctgcctcccag
gctgagttccctagtcggacctcgatgctcaggcagccatgtgcttgcccagtcaccccc
ccggctggcacagtggccttgggcagagcctccccgccactcttccagtcccgaggcagc
agtcccctacagcttaacctgcttcagctagaggaagcacctgaaagtagtactggagct
gcagggaccttggggaccacggggacagcagcttctggtctggactgcacatctggcgca
tctcgggaccggcagccaaaggcacctccaacatgcagtgagccctcagacacccagaac
agtgatgccatctccacctccagtgacctgctcaacctcctcctgggcgaggacctctgc
tcagccaccggctcagcactgtcgagaagcggggcatctgccacctcagactcactgggc
tccagctccctgggctgtgacacatcccggagtggggcaggcagcagtgatacaagtcac
accagcaaatactttggaagcattgactcttcagagaataatcacaaagcaaaaatgatc
acagacacggaggagagtgaacagttcattaagtacgtcttgcaggaccccatctggctg
ctgatggccaacacagacgacaatatcatgatgacataccagctgccctcccgggatctc
caggcggtcttgaaagaggaccaggagaagctgaagctgctgcagaggtcccagccccac
ttcacggagggccagaggcgagagcttcgagaggttcatccgtgggtccacaccgggggt
ctgcctaccgccatcgacgtaacagggtgtgtttactgtgaaagtgaggagaaaggcaac
ctttgtctgccatatgaggaagacagtccttccctgggactctgtgatacctcagaagcc
aaagaggaggagagcggacagctggccaatcctaggaaggaggcccagacgtaa

DBGET integrated database retrieval system