KEGG   Rattus norvegicus (rat): 63843
Entry
63843             CDS       T01003                                 

Gene name
P2ry4, P2Y4
Definition
(RefSeq) pyrimidinergic receptor P2Y4
  KO
K04271  P2Y purinoceptor 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
rno04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    63843 (P2ry4)
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    63843 (P2ry4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    63843 (P2ry4)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    63843 (P2ry4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srw
Other DBs
NCBI-GeneID: 63843
NCBI-ProteinID: NP_113868
RGD: 61798
Ensembl: ENSRNOG00000002953
Vega: OTTRNOG00000000584
UniProt: O35811
Position
Xq22
AA seq 361 aa
MTSAESLLFTSLGPSPSSGDGDCRFNEEFKFILLPMSYAVVFVLGLALNAPTLWLFLFRL
RPWDATATYMFHLALSDTLYVLSLPTLVYYYAARNHWPFGTGLCKFVRFLFYWNLYCSVL
FLTCISVHRYLGICHPLRAIRWGRPRFASLLCLGVWLVVAGCLVPNLFFVTTNANGTTIL
CHDTTLPEEFDHYVYFSSAVMVLLFGLPFLITLVCYGLMARRLYRPLPGAGQSSSRLRSL
RTIAVVLTVFAVCFVPFHITRTIYYQARLLQADCHVLNIVNVVYKVTRPLASANSCLDPV
LYLFTGDKYRNQLQQLCRGSKPKPRTAASSLALVTLHEESISRWADTHQDSTFSAYEGDR
L
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgaccagtgcagaatccttgctattcacatcactaggtcccagcccaagttctggagat
ggtgattgtaggtttaatgaggagttcaagttcatcctgttgcctatgagctatgcagtt
gtgtttgtgctgggcctggccctcaatgctccaaccctctggctgttcctcttccgcctt
cgaccctgggatgcaacagccacctacatgttccacctggcattgtcagacaccttgtat
gtgctgtcactgcccaccctcgtctactactatgctgccagaaaccactggccctttggc
actggcctttgcaagtttgtccgctttctcttctattggaacctctactgtagtgtcctt
ttcctcacctgcatcagtgtgcaccgatacctgggtatctgccacccactgcgggcaatc
cgctggggccgccctcgatttgcaagccttctctgcctgggtgtttggttggtagtagct
ggctgcctcgtgcccaatcttttctttgtgacaaccaatgccaatggaactaccatcctg
tgccatgacactactctgccagaggagtttgaccactacgtctacttcagttcggcagtc
atggtgctgctctttggtttgcccttcttgatcaccctggtctgctatggactcatggcc
cggcgactgtatcgacctttgccaggagctggacagtcatcttctcggctccgttccctc
cgtaccattgctgtggtgctgactgtctttgctgtctgcttcgtgcccttccacatcacc
cgcacaatttattaccaggcaagactgttgcaagctgactgtcatgtgctgaacattgtc
aatgtggtttacaaggtgactcgacccctggccagtgctaatagctgtcttgatccagtg
ctctatctcttcacgggggacaagtatcgaaaccagctccagcagctatgccgaggcagc
aaacccaagccccgaacagctgcctcctccctggccttggtgactctacatgaggaaagc
atcagcaggtgggcggacacccaccaagacagcaccttctctgcttatgagggagatcga
ttgtaa

DBGET integrated database retrieval system