KEGG   Rattus norvegicus (rat): 63852
Entry
63852             CDS       T01003                                 

Gene name
Pter, Rpr-1, Rpr1
Definition
(RefSeq) phosphotriesterase related
  KO
K07048  phosphotriesterase-related protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    63852 (Pter)
SSDB
Motif
Pfam: PTE TatD_DNase
Other DBs
NCBI-GeneID: 63852
NCBI-ProteinID: NP_071560
RGD: 61313
Ensembl: ENSRNOG00000017328
UniProt: Q63530
Position
17q12.3
AA seq 349 aa
MSSLSGKVQTVLGPVEPSQLGRTLTHEHLTMAFDSFYCPPPPCQEAASREPIMMKNLFWI
QKNPYSHQENLQLNQEVEAVREELLYFKAKGGGAVVENTTTGLSRDVRTLKWLAEQTGVH
IIAGAGFYVDATHSAATRAMSVEQLTDVLISEILHGADGTSIKCGVIGEIGCSWPLTDSE
RKVLQATAHAQAQLGCPVIIHPGRNPGAPFQIIRVLQEAGADISKTVMSHLDRSIFDKKE
LLEFAQLGCYLEYDLFGTELLNYQLSPDIDMPDDNKRIRRVRFLVNEGYEDRILMAHDIH
TKHRLMKYGGHGYSHILTNVVPKMLLRGLTERVLDKILRENPKQWLTFK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgtcttccttaagtggaaaagtacaaacagttctgggccccgtagaacccagccaactg
ggacgcaccctgacccatgagcatctgacgatggcctttgacagtttttattgcccacct
cctccatgccaggaagctgcctccagggaacctatcatgatgaaaaatttattttggatt
cagaaaaatccttactcccatcaagagaatcttcagttgaatcaggaggtagaagccgta
agagaagaactgttgtatttcaaggctaagggcggaggagccgtggtggagaacacgacc
actggactcagcagggatgtgcgtacgctgaagtggctggcagagcagactggagtccac
atcatagctggtgctgggttttacgtagacgcaactcactctgcagcaaccagagccatg
tcggtggagcagcttacagatgtcctcattagtgaaattctccatggagctgacggcacc
agtatcaagtgtggagttattggagaaattggctgttcctggcctttgactgacagcgag
agaaaggtacttcaggctacggctcacgcccaagctcagcttggttgtccggtgatcatc
caccctggacggaacccaggtgcaccattccagatcatccgagtactgcaagaagcaggg
gcggacatctctaaaacggtcatgtcccaccttgacaggtctatatttgataagaaagag
ctgctggagtttgctcaacttggctgctacttggaatatgatctctttggtacggagctc
cttaattaccagctaagcccagatattgatatgcctgatgataacaaaagaattagaagg
gtccgttttctggtgaacgaaggctatgaagatcggattctcatggcacacgacatacac
acaaagcatcgactgatgaagtacggaggtcacggctactcacacatcctcaccaacgtc
gttcctaagatgctcctcagaggtctgactgagagggtgcttgataagatactcagagaa
aaccctaaacaatggctgacttttaaatag

DBGET integrated database retrieval system