KEGG   Rattus norvegicus (rat): 63865
Entry
63865             CDS       T01003                                 

Gene name
Lgmn
Definition
(RefSeq) legumain precursor
  KO
K01369  legumain [EC:3.4.22.34]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
rno04612  Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    63865 (Lgmn)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    63865 (Lgmn)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    63865 (Lgmn)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.34  legumain
     63865 (Lgmn)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C13: legumain family
   63865 (Lgmn)
SSDB
Motif
Pfam: Peptidase_C13
Other DBs
NCBI-GeneID: 63865
NCBI-ProteinID: NP_071562
RGD: 619832
Ensembl: ENSRNOG00000007089
UniProt: Q9R0J8 Q5PPG2
Position
6
AA seq 435 aa
MIWKVAVLLSLVLGAGAVHIGVDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHR
NGIPDEQIIVMMYDDIANNEENPTPGVVINRPNGTDVYKGVPKDYTGEDVTPENFLAVLR
GDEEAVKGKGSGKVLKSGPRDHVFVYFTDHGATGILVFPNEDLHVKDLNKTIRYMYEHKM
YQKMVFYIEACESGSMMNHLPDDIDVYATTAANPNESSYACYYDEERSTYLGDWYSVNWM
EDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMKHRASSPISLPP
VTHLDLTPSPDVPLTILKRKLLRTNNMKESQVLVGQIQHLLDARHIIEKSVQKIVSLLAG
FGETAQKHLSERAMLTAHDCHQEAVTHFRTHCFNWHSVMYEHALRYLYVLANLCEKPYPI
DRIKMAMDKVCLSHY
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgatctggaaagtggctgtgcttctcagcctagtgctgggtgctggtgctgttcacatc
ggtgtggatgaccctgaggacggtggcaagcactgggtggtgattgtggcgggctccaat
ggctggtataattaccgacaccaggcagacgcatgccacgcctaccagatcatccaccgg
aacgggattcctgacgagcagatcatagtgatgatgtatgacgacatcgccaacaatgaa
gaaaacccgactccaggtgttgtgatcaaccgacctaacggcacagacgtgtacaaggga
gtcccgaaggactacactggagaggatgtgactccagagaatttcctcgcagtgctgaga
ggcgacgaagaagctgtgaagggcaaagggtccggaaaagtcttgaagagtgggccccgg
gatcatgtatttgtttacttcaccgaccacggagccactggaatcctggtgtttcctaac
gaagatcttcatgtcaaggacctgaataagactattcgctacatgtatgagcacaaaatg
taccagaagatggtgttttacattgaagcatgtgagtccggctccatgatgaaccacctg
cccgatgacatcgatgtttatgcaaccactgccgccaaccccaacgagtcatcttacgcc
tgctactatgacgaggagaggagcacttacctgggtgactggtacagcgtcaactggatg
gaagattccgatgtggaggatctgaccaaagagacacttcacaagcagtaccacctggtc
aagtcccacaccaacaccagtcacgtcatgcagtatgggaacaaatctatctctaccatg
aaagtgatgcagtttcaaggaatgaagcacagagccagttcacccatctcgctgcctcca
gtcacacaccttgacctcacccccagccctgacgtgcccctgaccatcctgaaaaggaag
ctgctgagaaccaacaacatgaaggaatcccaagttctcgtcgggcagatccagcacctt
ctggatgccaggcacatcattgagaagtctgtgcaaaagatcgtttccctgctggcagga
tttggggaaactgctcagaaacatctgtcagagagagccatgctcacagcacatgactgc
catcaggaggccgtgacccacttccgcacacactgctttaactggcactcagtcatgtac
gagcatgccttgcggtatttgtacgtgctggccaacctctgtgagaagccatatccgatt
gacaggataaagatggccatggacaaagtgtgccttagtcactactga

DBGET integrated database retrieval system