KEGG   Rattus norvegicus (rat): 63881
Entry
63881             CDS       T01003                                 

Gene name
Rapgef1
Definition
(RefSeq) rap guanine nucleotide exchange factor 1 isoform X19
  KO
K06277  Rap guanine nucleotide exchange factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04510  Focal adhesion
rno04722  Neurotrophin signaling pathway
rno04910  Insulin signaling pathway
rno05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    63881 (Rapgef1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    63881 (Rapgef1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    63881 (Rapgef1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    63881 (Rapgef1)
 09160 Human Diseases
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    63881 (Rapgef1)
SSDB
Motif
Pfam: RasGEF RasGEF_N
Other DBs
NCBI-GeneID: 63881
NCBI-ProteinID: XP_006233964
RGD: 619793
Ensembl: ENSRNOG00000014316
Position
3
AA seq 1084 aa
MGNAIEKQKPLRQSHLCPWKQDSQRSHLSSFTMKLMDKFHSPKIKRTPSKKGKPAEVSKT
PEKPVSKEARDRFLPEGYPIPLDLEQQAVEFMSTSAVDSRSQRQKNLCWLEEKEKEVVSA
LRYFKTIVDKMAIDKKVLEMLPGSASKVLEAILPLVQTDPRIQHSSALSSCYSRVYQSLA
NLIRWSDQVMLEGVNSEDKEMVTTVKGVIKAVLDGVKELVRLTIEKQGRPSPTSPVKPSS
PASKPDGQPELPLTEREMEILNKTSVSPSTELLPDSTSEEVAPPKPPLPGIRVVDNSPPA
LPPKKRQSAPSPTRVAVVAPMSRAVSGSSLPVGINRQDFDVECYTQRRLSGGSRSCGGES
PRLSPCSSTGKLSRSDEQLSSLDRDSGQCSRNTSCETLDHYDPDYEFLQQDLSNADQTPP
QAACNLSPLPESMGESGPPFVGYSFQLPLGSCLQQDGQQTDTPPALPEKKRRSAVSQTTD
SSGCRVSYERHPSQYDNISEDDLQNPAQPVSYPPFAAILPFQQGASSTPVEFVGDFSVPE
SAGDPEKPPPLPEKKNKHMLAYMQLLEDYSEPQPSMFYQTPQSEHIYQQKNKMLMEVYGF
SDSFCGSDSTQELAPPPALPPKQRQLEPPSGKDGHPRDLSVSSASGKDSRENGERSPKSL
DALESAQSEEEVDELSLIDHNEIMARLTLKQEGDDGPDVRGGSGDILLVHATETDRKDLV
LYCEAFLTTYRTFISPEELIKKLQCRYEKFSPFADTFKKRVSKNTFFVLVRVVDELCLVE
LTEEILKLLMELVFRLVCSGELSLARVLRKNILDKVDQKKLLRCAHSDQPLAARGVAARP
GTLHDFHSHEIAEQLTLLDAELFYKIEIPEVLLWAKEQNEEKSPNLTQFTEHFNNMSYWV
RSVIMLQEKAQDRERLLLKFIKIMKHLRKLNNFNSYLAILSALDSAPIRRLEWQRQTSEG
LAEYCTLIDSSSSFRAYRAALSEVEPPCIPYLGLILQDLTFVHLGNPDYIDGKVNFSKRW
QQFNILDSMRCFQQVHYEIRRNDDIINFFNDFSDHLAEEALWELSLKIKPRNITRRKTDR
EEKT
NT seq 3255 nt   +upstreamnt  +downstreamnt
atgggcaatgccattgaaaaacagaagcccctgagacaaagccatctgtgcccctggaaa
caagactctcagcgctctcatctctcctccttcaccatgaagctgatggacaaattccac
tctcctaaaatcaagagaacaccatccaagaagggaaagccagctgaggtgtcgaagact
cctgagaagcctgtgagcaaagaggcaagagacagatttctaccagagggctaccctatc
cccttggatctggagcagcaggcagtagaatttatgtccaccagtgctgtggattccagg
tctcagaggcagaagaacctgtgctggctggaggagaaagagaaggaggttgtcagtgcc
ttgcgctactttaagaccattgtggacaaaatggccattgataagaaggttctggagatg
ctcccggggtcagccagcaaggtgctggaggccatcttacccctggtgcagactgaccct
cggatccagcacagctcagccctctcctcttgctatagccgagtgtaccagagccttgcc
aaccttatccgctggtctgaccaggtgatgctcgagggtgtgaactcagaagataaggag
atggtgacgactgtgaagggtgtcatcaaagctgtgctggatggagtgaaggaactggtg
aggctaaccattgagaagcaaggccggccatcaccaacaagcccagtgaagcccagttcc
ccagccagcaagcctgatggccagcctgagctccctctgacagaacgagaaatggagatt
ctgaacaagacaagtgtgtcaccatccactgaactgctcccagactccaccagtgaagag
gttgcgccccccaagccccctttacctggcatccgggtggttgataacagtccaccagca
ttaccacccaagaaaaggcaatctgctccatcccctacccgggtggctgtggtagccccc
atgagtcgtgctgtcagtggctccagtttgcctgttggaatcaataggcaggactttgat
gttgaatgttacacccagaggcgcctgtcaggaggcagccgctcctgtggtggtgaatct
cctcgcctgtccccctgcagcagtacaggcaagctcagccggtcagacgagcagctgtcc
tccctagacagggatagcgggcagtgctcacggaacacaagctgtgaaacactagatcac
tatgaccccgactatgaattcctccagcaagacctctccaatgcagaccagacccctcca
caggcagcctgtaacctcagcccactgccggagtccatgggggagtctgggcccccattt
gttggctactctttccagctgcctctgggcagctgtctccagcaggatggacagcagaca
gatactccacctgcccttcctgagaagaagcgtaggagcgcagtctcccagaccacggac
agctctggctgcagggtgtcctatgagcgacacccctcacagtatgacaacatctcagaa
gatgatctgcagaacccagcccagcctgtgtcctacccgccctttgctgctatcctgccc
tttcagcagggagcttcttccacccctgttgagtttgtgggtgatttcagtgttcctgag
tcagccggtgacccagaaaagccacctcctctaccagagaagaaaaacaaacacatgctg
gcctacatgcaactgctggaggactactcagagccacagccctccatgttctaccagaca
ccgcagagtgagcacatctaccagcagaagaacaagatgctcatggaggtctatggcttc
agcgactccttctgtggtagtgactccacgcaggagctggcccctccacccgctttgccc
cccaagcagcggcagctggaaccgccatctgggaaggacggacatcccagagatctttcg
gtcagcagtgcatctgggaaggacagcagagaaaatggggagaggtccccgaagtcactg
gatgctctggagtcagcccagtcagaagaggaagtggatgaactgtccctcattgaccac
aatgaaatcatggccaggctgacactcaagcaagagggtgatgatggaccagatgttcgt
ggaggttcaggagacatcttactggtccatgctactgagacagacagaaaagacctggtc
ctgtactgtgaagccttcctgaccacctacagaaccttcatcagccccgaggagctcatc
aagaagctgcagtgccggtacgagaagttctctccctttgctgacacattcaagaagcga
gtgagcaagaacacattcttcgtgctggtgcgggtggtggacgagctctgcctggtggag
ctgacagaggagatcctgaagctgctgatggagctagtcttccgcctagtgtgcagtgga
gagctcagcttggccagggtactccgaaagaacattctggacaaggtggaccagaagaag
ctgctcaggtgtgcccattccgaccagcctttggcagccaggggtgttgcagccaggcca
ggaaccttgcatgatttccacagccacgagatagctgaacagctgacactgctggatgcc
gagcttttctataagatagagattcccgaagttttgctttgggccaaagagcagaatgaa
gagaagagccccaatctgacccagttcacagagcacttcaacaacatgtcctactgggtg
cggtccgtcatcatgctgcaggagaaggcccaggaccgggagaggctgctcctgaagttc
atcaagatcatgaagcacctgcgcaagctcaacaatttcaactcctacctggccatcctc
tccgcactggactcggcccccatccgcagactggagtggcagcgacagacctcagagggc
ctggctgagtactgcacgttgattgacagctcatcctccttccgagcctaccgggctgcc
ctctcagaggtggaacctccatgtatcccatacctaggtttgatcctgcaagacctgacg
ttcgtccacctgggaaacccagactacatagacgggaaggtcaacttctccaagcggtgg
cagcagttcaacatcctggacagcatgcgctgtttccagcaggtgcactatgaaatccgg
agaaacgacgacatcataaacttcttcaatgacttcagcgaccacctggccgaggaagcc
ctatgggaactctctctgaagatcaagcctaggaacataacaaggcggaaaacagaccgt
gaagagaagacctag

DBGET integrated database retrieval system