KEGG   Rattus norvegicus (rat): 63885Help
Entry
63885             CDS       T01003                                 

Gene name
Pde10a, Pde10a3
Definition
(RefSeq) phosphodiesterase 10A
  KO
K18438  cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10 [EC:3.1.4.17 3.1.4.35]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00230  Purine metabolism
rno01100  Metabolic pathways
rno04024  cAMP signaling pathway
rno05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    63885 (Pde10a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    63885 (Pde10a)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    63885 (Pde10a)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     63885 (Pde10a)
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     63885 (Pde10a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I GAF GAF_2 GAF_3 SpoVT_C HD H_kinase_N TraF
Motif
Other DBs
NCBI-GeneID: 63885
NCBI-ProteinID: NP_071572
RGD: 68434
Ensembl: ENSRNOG00000011310
UniProt: Q9QYJ6
Structure
PDB: 

Position
1q12
AA seq 794 aa AA seqDB search
MEDGPSNNASCFRRLTECFLSPSLTDEKVKAYLSLHPQVLDEFVSESVSAETVEKWLKRK
NNKAEDEPSPKEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNHLLLYELSSIIRIATKAD
GFALYFLGECNNSLCVFTPPGMKEGQPRLIPAGPITQGTTISAYVAKSRKTLLVEDILGD
ERFPRGTGLESGTRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCLSHQEVATANLAWA
SVAIHQVQVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALF
QVDHKNKELYSDLFDIGEEKEGKPVFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADP
RFNREVDLYTGYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCAL
ALHCANMYHRIRHSECIYRVTMEKLSYHSICTSEEWQGLMHFNLPARICRDIELFHFDIG
PFENMWPGIFVYMIHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAI
LQNNNGLFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTV
SILQLEGHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLHNQS
HRDRVIGLMMTACDLCSVTKLWPVTKLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKRD
EVPQGQLGFYNAVAIPCYTTLTQILPPTEPLLKACRDNLNQWEKVIRGEETAMWISGPAT
SKSTSEKPTRKVDD
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggaagatggaccctctaacaatgcgagttgcttccgaaggctgaccgagtgtttcctc
agccccagtttgacggatgaaaaggtgaaggcctatctttccctccatccccaggtatta
gacgagtttgtttctgaaagtgttagtgcggagactgtggagaagtggctgaagaggaaa
aacaacaaagcagaagatgaaccatctcctaaggaagtcagcaggtaccaggacacgaac
atgcagggagtcgtgtacgagctgaacagctacatagagcagcgcctggacaccggcggg
gacaaccacctgctcctgtacgagctaagcagtatcatcaggatagccacaaaagccgac
ggatttgcactgtacttccttggagagtgcaataatagtctgtgtgtcttcacaccaccc
ggaatgaaggaaggtcaaccccgtctcatccccgcagggcccatcacccagggcaccacc
atctctgcctatgtggccaagtctaggaagaccctgctggtagaggacatccttggggat
gagcgatttcccagaggcactggtctggagtcaggaacccgaatccagtctgtcctttgc
ttgcctattgtcactgccattggagacttgattggcatccttgaactgtacaggcactgg
ggcaaagaggccttctgcctcagccatcaggaggttgcaaccgccaatctcgcttgggct
tccgtagcaatacaccaggtgcaggtgtgcagaggtctcgccaagcagaccgaactgaat
gacttcctgctcgatgtatcaaagacatactttgataacatagtcgccatagactctcta
cttgaacacatcatgatatatgcaaaaaatctagtgaacgccgaccgctgcgcgctcttc
caggtggaccacaagaacaaggagctgtactcggacctgtttgacattggggaggagaag
gaggggaagcccgtcttcaagaagaccaaggagatcagattttccattgagaaagggatt
gctggtcaagtggcaagaacgggagaagtcctgaacattcctgatgcctacgcagacccg
cgctttaacagggaggtggacctgtacacaggctataccacgcggaacattctgtgtatg
cccatagtgagccgcggcagcgtgatcggtgtggtgcaaatggttaacaagatcagcggc
agcgccttctccaagacggatgagaacaacttcaagatgtttgctgtcttctgcgctctg
gccctgcactgcgctaacatgtaccacaggatccgccactcagagtgcatctacagggtt
accatggagaagctgtcttaccacagcatctgcacctctgaggaatggcaaggcctcatg
cacttcaacttgccagcacgcatctgccgggacatcgagctattccactttgacattggt
cctttcgagaacatgtggcctgggatctttgtctacatgatccatcggtcttgtgggaca
tcctgttttgaacttgaaaaattgtgccgttttatcatgtctgtgaagaagaactatagg
cgggttccttaccacaactggaagcatgcagtcacggtggcgcactgcatgtacgccata
cttcaaaacaacaatggcctcttcacagaccttgagcgcaaaggcctgctaattgcctgt
ctgtgccatgacctggaccacaggggcttcagtaacagctacctgcagaaattcgaccac
cccctggctgcgttgtactccacctccaccatggagcaacaccacttctcccagacggtg
tccatcctccagctggaaggacacaacatcttctccaccctgagctccagcgagtacgag
caggtgctggagatcatccgcaaagccatcatcgccactgacctcgcactgtactttggg
aacaggaagcagttggaggagatgtaccagacagggtcgctgaacctccacaaccagtcc
catcgagaccgcgtcatcggcttgatgatgactgcctgcgatctttgctctgtgacgaaa
ctatggccagttacaaaattgacagcaaatgatatatatgcagagttctgggctgagggg
gatgagatgaagaagttggggatacagcccatccctatgatggacagagacaagcgagat
gaagtccctcaaggacagcttggattctacaatgctgtggccatcccctgctataccacc
ctgacgcagatcctcccacccacagagcctctgctgaaggcctgcagggataacctcaat
cagtgggagaaggtaattcgaggggaagagacagcaatgtggatttcaggcccagcaact
agcaaaagcacatctgagaagccgaccaggaaggtcgatgactga

DBGET integrated database retrieval system