KEGG   Rattus norvegicus (rat): 63886
Entry
63886             CDS       T01003                                 

Gene name
Abcb9
Definition
(RefSeq) ATP-binding cassette sub-family B member 9
  KO
K05656  ATP-binding cassette, subfamily B (MDR/TAP), member 9
Organism
rno  Rattus norvegicus (rat)
Pathway
rno02010  ABC transporters
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    63886 (Abcb9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    63886 (Abcb9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    63886 (Abcb9)
Transporters [BR:rno02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB2, 3, 8, 9, 10 subgroups
    63886 (Abcb9)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 AAA_22 RsgA_GTPase ABC_membrane_3 MCU AAA_29 AAA_30 DUF4191 AAA_23
Other DBs
NCBI-GeneID: 63886
NCBI-ProteinID: NP_071574
RGD: 620254
Ensembl: ENSRNOG00000001082
UniProt: Q9QYJ4
Position
12
AA seq 762 aa
MRLWKAVVVTLAFVSMDVGVTTAIYAFSHLDRSLLEDIRHFNIFDSVLDLWAACLYRSCL
LLGATIGVAKNSALGPRRLRASWLVITLVCLFVGIYAMAKLLLFSEVRRPIRDPWFWALF
VWTYISLAASFLLWGLLATVRPDAEALEPGNEGFHGEGGAPAEQASGATLQKLLSYTKPD
VAFLVAASFFLIVAALGETFLPYYTGRAIDSIVIQKSMDQFTTAVVVVCLLAIGSSLAAG
IRGGIFTLVFARLNIRLRNCLFRSLVSQETSFFDENRTGDLISRLTSDTTMVSDLVSQNI
NIFLRNTVKVTGVVVFMFSLSWQLSLVTFMGFPIIMMVSNIYGKYYKRLSKEVQSALARA
STTAEETISAMKTVRSFANEEEEAEVFLRKLQQVYKLNRKEAAAYMSYVWGSGLTLLVVQ
VSILYYGGHLVISGQMSSGNLIAFIIYEFVLGDCMESVGSVYSGLMQGVGAAEKVFEFID
RQPTMVHDGRLAPDHLEGRVDFENVTFTYRTRPHTQVLQNVSFSLSPGKVTALVGPSGSG
KSSCVNILENFYPLQGGRVLLDGEPIGAYDHKYLHRVISLVSQEPVLFARSITDNISYGL
PTVPFEMVVEAAQKANAHGFIMELQDGYSTETGEKGAQLSGGQKQRVAMARALVRNPPVL
ILDEATSALDAESEYLIQQAIHGNLQRHTVLIIAHRLSTVERAHLIVVLDKGRVVQQGTH
QQLLAQGGLYAKLVQRQMLGLEHPLDYTAGHKEPPSNTEHKA
NT seq 2289 nt   +upstreamnt  +downstreamnt
atgaggctgtggaaggcggtagtggtgacgctggccttcgtgagcatggacgtcggcgtg
accacggccatctatgccttcagccacctggatcgcagcctgctggaggacatccgacac
tttaacatcttcgactcggtgctggacctctgggctgcctgcctgtaccgcagctgcctg
ctgctgggggctaccatcggtgtggccaagaacagcgctctggggccacggcgcctgcgg
gcctcgtggctcgtcatcaccctcgtgtgcctctttgtgggcatctatgccatggccaaa
ctgctactcttctcagaggtgcgcaggcccatccgggacccatggttctgggcgctcttc
gtatggacctacatctcgctggctgcctccttcctgctgtgggggctgctggccaccgtg
cggccggacgcggaggccctggagccggggaacgagggcttccacggtgagggtggggcc
cctgctgagcaggcatcaggggccacgctgcagaagctgctgtcctacacaaagcctgat
gtggccttcctagtagctgcctctttcttcctcatcgtagcggctctgggagagaccttc
ctgccctactacactggccgggccatcgacagcatcgtcatccagaaaagcatggaccag
ttcaccacggccgtcgtcgtcgtctgcctgctggccatcggcagctcattggccgcaggt
attcggggcggcattttcaccctcgtatttgccagactgaacattcgccttcgcaactgt
ctcttccgctccctggtgtcacaggagacgagcttctttgacgagaatcgcacaggggac
ctcatctcccgcctcacctctgacaccaccatggtcagcgacctggtctcccagaacatc
aacatcttcctgaggaacacggtcaaggtcacgggcgtggtggtcttcatgttcagcctc
tcctggcagctctccctggtcaccttcatgggcttccccatcatcatgatggtgtccaac
atctacggcaagtactacaagaggctctccaaggaggtccagagtgccctggccagagcc
agcaccacagccgaggagaccatcagcgccatgaagacggtccgcagctttgccaatgag
gaagaggaggcagaggtgttcctgcggaagcttcagcaggtctacaagctgaacaggaag
gaggccgcagcctacatgtcctacgtctggggcagtgggctcacactcctggtggtccag
gtcagtatcctctactacgggggccacctcgtcatctcggggcagatgagcagcggcaac
ctcatcgccttcatcatctatgagtttgtcctgggagactgcatggagtccgtgggctcc
gtctatagcggcctgatgcagggagtgggggctgctgagaaggtgttcgagttcattgac
cggcagccaaccatggtgcatgacggaagattggcccctgaccatctcgagggcagggtg
gactttgagaatgtaaccttcacctaccgcactcggccccacacacaggtcctacagaat
gtctccttcagcctgtccccaggcaaggtgacggctctggtggggccctcgggcagcgga
aagagctcctgtgtgaacatcctggagaacttctaccctctgcagggcggccgggtgttg
ttggacggcgagcccatcggcgcctatgaccacaagtacctgcaccgcgtgatctcactg
gtaagccaggagcctgtgctgttcgcccgctccatcacagacaacatctcctacggcctg
cctaccgtgcccttcgagatggtggtggaggctgcacagaaggccaatgctcacggcttc
atcatggagctgcaggacggatacagcacagagaccggggaaaagggagcccagctgtca
ggtggccagaagcagcgggtggccatggcacgtgcactagtgcggaaccctcctgtgctc
atcctggacgaagccaccagtgccctggacgcagagagtgaatacctgattcagcaggcc
atccacggcaacctgcagagacacacggtgctgatcatcgcacaccggctgagtactgta
gagcgggcgcacctcatcgtggtgctagacaagggccgtgtggtacagcagggtacacac
cagcagctgttggcacagggcggcctctatgccaagctggtgcagcgtcagatgctgggg
ctcgagcaccccttggactacacggctggccacaaggagccacccagcaacactgaacac
aaggcctga

DBGET integrated database retrieval system