KEGG   Rattus norvegicus (rat): 63938
Entry
63938             CDS       T01003                                 

Gene name
Hibadh
Definition
(RefSeq) 3-hydroxyisobutyrate dehydrogenase
  KO
K00020  3-hydroxyisobutyrate dehydrogenase [EC:1.1.1.31]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00280  Valine, leucine and isoleucine degradation
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    63938 (Hibadh)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.31  3-hydroxyisobutyrate dehydrogenase
     63938 (Hibadh)
SSDB
Motif
Pfam: NAD_binding_2 NAD_binding_11 2-Hacid_dh_C F420_oxidored 3HCDH_N IlvN DpaA_N TrkA_N
Other DBs
NCBI-GeneID: 63938
NCBI-ProteinID: NP_071579
RGD: 708399
Ensembl: ENSRNOG00000008063
UniProt: P29266
Position
4q24
AA seq 335 aa
MAASLGFRGAASGLRYWSGRRRPVGSLAAVCSRSMASKTPVGFIGLGNMGNPMAKNLIKH
GYPLILYDVFPDVCKEFKEAGEQVASSPADVAEKADRIITMLPSSMNSIEVYSGANGILK
KVKKGSLLIDSSTIDPSVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVENE
FAAAQELLGCMGSNVLYCGAVGSGQSAKICNNMLLAISMIGTAEAMNLGIRSGLDPKLLA
KILNMSSGRCWSSDTYNPVPGVMDGVPSSNNYQGGFGTTLMAKDLGLAQDSATSTKTPIL
LGSVAHQIYRMMCSKGYSKKDFSSVFQYLREEETF
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggcagcctccttggggttccggggggcagcctccggcctccggtactggagcggccgg
cggcggcccgtgggcagccttgcagcggtgtgttctaggtcaatggcttctaagactcca
gttggattcattggactgggaaacatgggcaatccaatggcaaaaaatctcataaaacat
ggctacccactcatcctctatgatgtgttccctgacgtatgcaaagagtttaaagaggct
ggtgaacaggtagcgtcctccccagcagatgtagcggaaaaggctgacaggattatcaca
atgctgccctccagtatgaattcaatagaagtttattctggagcaaatggaattctaaaa
aaagtgaagaaaggctcattattaatagattccagtactattgatccttcagtttcaaaa
gaattggcaaaagaagttgagaaaatgggagctgttttcatggacgcccctgtttctggt
ggcgtaggagctgctcggtctggaaaccttacattcatggtgggaggagttgaaaatgag
tttgctgctgcccaagagttgctggggtgcatgggctccaatgtattgtactgtggagct
gtcgggtctgggcagtctgcaaagatctgtaacaacatgctgttggctataagtatgatc
ggaactgctgaagctatgaaccttggaatcaggtcaggccttgacccaaaactattggct
aaaatcctgaatatgagctcaggacgatgctggtccagcgacacttacaaccctgtacct
ggggttatggatggagttccctcatctaataactaccaaggtggatttgggacaacactc
atggccaaggatctgggattagctcaagactctgccaccagcaccaagaccccaattctc
ctcggaagcgtggcccatcagatatacaggatgatgtgttcaaagggctactcaaagaaa
gacttctcctctgtgttccagtatctgcgggaggaggaaaccttctga

DBGET integrated database retrieval system