KEGG   Rattus norvegicus (rat): 63995Help
Entry
63995             CDS       T01003                                 

Gene name
Dusp10, Mkp-5, Mkp5
Definition
(RefSeq) dual specificity phosphatase 10
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    63995 (Dusp10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    63995 (Dusp10)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     63995 (Dusp10)
    3.1.3.48  protein-tyrosine-phosphatase
     63995 (Dusp10)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    63995 (Dusp10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese PTPlike_phytase Y_phosphatase Init_tRNA_PT
Motif
Other DBs
NCBI-GeneID: 63995
NCBI-ProteinID: NP_001099204
RGD: 1310844
Ensembl: ENSRNOG00000004003
UniProt: D3ZBG7
Position
13q26
AA seq 482 aa AA seqDB search
MPPSPLDDRVVVALSRPVRPQDLNLCLDSSYLGSASPGSNNHTPVIATAVVTLKAANLTY
MPSSSGSARSLNCGCSSTSCCTVATYDKDHQAQTQAIAAGTATTAIGTSTTCPANQMVNN
NENIGSLSPSGGVGSPVSGTPKQLASIKIIYPNDLAKKMTKCSKSHLPSQGPVIIDCRPF
MEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCREGKDSFKRIFSKEIIVYDENT
NEPSRVTPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHGNLCDNSLQLQECREVGGGA
SAASSVLPQSVPSTPDIESAELTPILPFLFLGNEQDAQDLDAMQRLNVGYVINVTTHLPL
YHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQAGVSRSATIVI
AYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNNGVTPRILTPKLMGMET
VV
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcctccgtcccctttagacgacagggtagtagtagcactgtctaggcctgtccgacct
caggatctcaacctttgtttagactccagctacctgggctctgccagcccaggcagcaat
aaccacactcctgtcattgccacagccgtcgtgaccctcaaggctgcgaatctgacgtat
atgccctcatccagcggctctgcccgctccctgaattgcggatgcagcagcactagctgc
tgcactgtggcaacctacgacaaggatcatcaggcccagactcaagccatcgctgcaggc
actgccaccactgccataggaacctcgaccacctgccctgctaaccagatggtcaacaac
aatgaaaatataggctctttaagtccatcgggcggggtgggcagccccgtgtcagggact
cccaagcagctagccagcatcaaaatcatctaccccaatgacctggcgaagaagatgacc
aaatgcagcaagagtcacctgcccagccagggtcctgtcatcattgactgcaggcctttc
atggagtacaacaagagtcacatccaaggagctgtccacattaactgtgcagataagatc
agccggcggaggctgcaacagggcaagatcactgtcttagacttgatttcctgtagagaa
ggcaaagactctttcaagaggattttttccaaagaaatcatagtttatgatgagaatacc
aatgagccgagccgtgtgacgccatcccaaccacttcacatagttctcgagtccctgaag
agagaaggcaaagaacccctggtattgaaagggggactcagtagttttaaacagaaccat
ggaaacctctgtgacaactccctccagctccaagagtgccgggaggtggggggtggtgcc
tctgcggcctcgagcgtgctacctcagtctgtcccctccacccctgacatcgagagcgca
gagctgacacccatcctgcccttcctgtttcttggcaatgagcaggatgctcaggaccta
gacgccatgcagaggctcaatgtcggctatgtcatcaacgtcaccacacaccttcctctc
taccactatgagaaaggcctcttcaactacaagaggctgccagccacagacagcaacaag
cagaacttgcggcagtactttgaagaggcattcgaattcattgaggaagctcatcagtgt
gggaagggccttctcatccactgccaggccggcgtgtcccgttctgccaccattgtcatc
gcctacctgatgaagcacacacggatgaccatgactgacgcttacaaattcgtcaaaggc
aaacgaccaattatctccccgaacctcaacttcatggggcagttgctggaatttgaggaa
gacctaaacaatggcgtgacaccacggatccttacaccaaagctgatgggcatggagaca
gttgtgtga

DBGET integrated database retrieval system