KEGG   Rattus norvegicus (rat): 63997
Entry
63997             CDS       T01003                                 
Symbol
Slc29a1
Name
(RefSeq) equilibrative nucleoside transporter 1
  KO
K15014  solute carrier family 29 (equilibrative nucleoside transporter), member 1/2/3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    63997 (Slc29a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    63997 (Slc29a1)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC29: Facilitative nucleoside transporter
   63997 (Slc29a1)
SSDB
Motif
Pfam: Nucleoside_tran
Other DBs
NCBI-GeneID: 63997
NCBI-ProteinID: NP_113872
RGD: 61899
Ensembl: ENSRNOG00000019752
UniProt: O54698
Position
9:15399661..15414203
AA seq 457 aa
MTTSHQPQDRYKAVWLIFFVLGLGTLLPWNFFITATQYFTSRLNTSQNISLVTNQSCEST
EALADPSVSLPARSSLSAIFNNVMTLCAMLPLLIFTCLNSFLHQKVSQSLRILGSLLAIL
LVFLVTATLVKVQMDALSFFIITMIKIVLINSFGAILQASLFGLAGVLPANYTAPIMSGQ
GLAGFFTSVAMICAVASGSKLSESAFGYFITACAVVILAILCYLALPWMEFYRHYLQLNL
AGPAEQETKLDLISEGEEPRGGREESGVPGPNSLPANRNQSIKAILKSIWVLALSVCFIF
TVTIGLFPAVTAEVESSIAGTSPWKNCYFIPVACFLNFNVFDWLGRSLTAICMWPGQDSR
WLPVLVACRVVFIPLLMLCNVKQHHYLPSLFKHDVWFITFMAAFAFSNGYLASLCMCFGP
KKVKPAEAETAGNIMSFFLCLGLALGAVLSFLLRALV
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgacaaccagtcaccagcctcaggacaggtataaggctgtctggctcatcttctttgtc
ctgggtctggggacactgctcccctggaatttttttataacagcaacccagtatttcaca
agccgcctgaacacgtcccagaatatatccttggtcaccaaccaatcatgcgaaagcacc
gaggccttggctgacccctcagtgtccttgccagcccggagttctctcagtgccatcttc
aacaatgtcatgaccctgtgtgccatgttgcccttgctgatcttcacctgcctcaactct
ttcctgcatcagaaggtgtctcagtcccttcggatcttgggcagcctgctggctatcctg
ttggtgttcctcgtcactgccaccctggtgaaggtgcagatggatgccctgtccttcttc
atcatcaccatgatcaagattgtgctcattaactcatttggtgccattttgcaagccagc
cttttcggtctggcaggcgtcctgccggccaactacacagcccccatcatgagtggccag
ggcctggctggcttcttcacctctgttgccatgatctgtgccgtcgccagtggctctaag
ctgtcagaaagtgcttttggttacttcatcacggcctgtgcagttgtcattctggccata
ctgtgttacctggccctgccttggatggaattctaccgacattacctgcagctcaacctt
gcggggcctgcagagcaggagaccaagttggatctcatcagtgaaggagaggagccaaga
ggaggaagagaggaatctggggtgccaggccccaactctctacccgccaacagaaaccaa
tccatcaaagccatactgaagagtatctgggtcctggctctgtctgtctgtttcatcttc
acagtcaccattgggttgttccctgctgtgactgctgaggtggaatccagcatcgcaggc
acaagtccctggaaaaactgctacttcatccctgtggcctgcttcctgaatttcaatgtc
tttgactggctaggccggagcctcacagctatttgcatgtggcctggtcaggacagccgc
tggttgccggtcctggtcgcctgcagggttgtgtttatccccctgctgatgctctgcaat
gtgaagcagcaccactacctgccctccctctttaagcatgatgtctggttcatcaccttc
atggccgcctttgccttctccaatggctacctcgccagcctctgcatgtgcttcgggccc
aagaaagtcaaaccggctgaggcagagactgccggaaacatcatgtccttctttctgtgt
ctgggcctggctctgggagctgtgttgtccttcttgttaagggcacttgtgtga

DBGET integrated database retrieval system