KEGG   Rattus norvegicus (rat): 64012Help
Entry
64012             CDS       T01003                                 

Gene name
Rad50
Definition
(RefSeq) RAD50 double strand break repair protein
  KO
K10866  DNA repair protein RAD50 [EC:3.6.-.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03440  Homologous recombination
rno03450  Non-homologous end-joining
rno04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    64012 (Rad50)
   03450 Non-homologous end-joining
    64012 (Rad50)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    64012 (Rad50)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    64012 (Rad50)
   03400 DNA repair and recombination proteins [BR:rno03400]
    64012 (Rad50)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.-  Acting on acid anhydrides
    3.6.-.-  
     64012 (Rad50)
DNA replication proteins [BR:rno03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    MRN complex
     64012 (Rad50)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     64012 (Rad50)
    BRCA1-C complex
     64012 (Rad50)
   NHEJ (non-homologous end-joining)
    MRX complex
     64012 (Rad50)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA_23 AAA_21 Rad50_zn_hook AAA_15 SbcCD_C SMC_N AAA_29 POTRA_3 DUF2703 ATPase-cat_bd AAA_16
Motif
Other DBs
NCBI-GeneID: 64012
NCBI-ProteinID: NP_071582
RGD: 621542
Ensembl: ENSRNOG00000033065
UniProt: Q9JIL8
Position
10q22
AA seq 1312 aa AA seqDB search
MSRIEKMSTLGVRSFGIEDKDKQIISFFSPLTILVGPNGAGKTTIIECLKYICTGDFPPG
TKGNTFVHDPKVAQETDVRAQIRLQFRDVNGEMVLVQRSMLCSQKSKKTEFKTLEGVITR
IKHGEKVSLSSKCAEIDREMISCLGVSKSVLNNVIFCHQEDSNWPLSEGKALKQKFDEIF
SATRYIKALDTLRQVRQTQGQKVKECQTELKYLRQNKEKACEIRDQITSKEAQLASSREI
VKAYENELEPLKNRLKEIEHNLSKIMRLDNEIKALDSRKKQMEKDNSELEQKMEKVFQGT
DEQLNDLYHNHQRTVREKERRLVDCQRELEKLSKEARLLNQERAELLVEQGRLQLQADRH
QEHIRARDSLIQSLAAHLELDGFERGPFSERQIKNFHELVRERQEREAKTASQLLSDLTD
KEALKQRQMDEMRDKKSGLGRMIELKTEILTKKQTELRNVRNELQQLEGSSDRILELDQE
LTKAERELSKAEKNSSIETLKAEILNLQSEKADLDRNLRKLDQEMEQLNHHTTTRTQMEM
LTKDKTDKDEQIRKIKSRHSDELTSLLGYFPNKKQLEDWLHSKSKEINQTRDRLAKLNKE
LASAEQNKNHINNELKKKEEQLSSYEDKLFDVCGSQDFESDLDRLKEDIEKSSKQRAMLA
GATAVYSQFITQLTDENQSCCPGCQRVFQTEAELQEVISDLQSKLRLAPDKLKSTESELK
KKERRRDEMLGLVPMRQSIIDLKEKEIPELRNRLQSVNRDIQRLKNDIEEQETLLGTVMP
EEESAKVCLTDVTIMERFQMELKDVERKIAQQAAKLQGVDLDRTVQQVNQEKQEKQHKLD
TVSSKIELNRKLIQDQQEQIQHLKSKTNELKSEKLQIATNLQRRQQMEEQTVELSTEVQS
LNREIKDAKEQINPLEIALEKLQQEKEELIHRKNTSNKMAQDKINDIKEKVKNIHGYMKD
IENYIQDGKDDYKKQKETELNEVVIQLNECDKHKEKINKEMGTMRQDIDTKKIQERWLQD
NLTLRKRREELKEVEEERKQHLKEMGQMQVLQMKNEHQKLEENIDTIKRNHSLALGRQKG
YEEEILHFKKELREPQFRDAEEKYREMMIVMRTTELVNKDLDIYYKTLDHAIMKFHSMKM
EEINKIIRDLWRSTYRGQDIEYIEIRSDADENVSASDKRRNYNYRVVMLKGDTALDMRGR
CSAGQKVLASLIIRLALAETFCLNCGILALDEPTTNLDRENIESLAHALVEIIKSRSQQR
NFQLLVITHDEDFVELLGRSEYVEKFYRVKKNIDQCSEIVKSSINSLGSYVH
NT seq 3939 nt NT seq  +upstreamnt  +downstreamnt
atgtcccggatcgaaaagatgagcactctgggcgtgcgaagttttgggatagaggataaa
gataagcaaattatctctttcttcagccccctcacaattttggttggacccaatggggcg
gggaagacgaccatcattgaatgtctaaagtatatttgtactggagatttccctcctgga
accaaaggaaatacatttgttcatgatcccaaggttgctcaagaaacagatgtgcgtgcc
caaattcgcctgcagtttcgtgatgtcaatggagagatggtacttgtgcagaggtccatg
ctttgcagtcagaaaagtaaaaaaaccgaatttaaaaccctggaaggagtcattactaga
ataaagcacggtgaaaaagtcagtctcagctccaaatgtgcagaaatcgaccgagaaatg
ataagttgtcttggggtttccaagtctgtgctaaacaatgttattttctgccaccaagaa
gactcaaattggcctctaagtgaaggaaaggctctgaagcagaaatttgatgagattttt
tcagcaacaaggtacattaaagccctagatacgcttcgacaggtacgacagacacaaggt
cagaaagtaaaagaatgtcaaacagaattgaaatatctgaggcaaaataaggagaaagct
tgtgagatccgagatcagatcactagtaaggaagcccagttagcatcttcacgggaaatt
gtcaaagcctatgagaatgagcttgagccattgaagaatcgcctgaaagagattgaacat
aacctctctaaaataatgagacttgacaatgaaattaaagccttggatagcagaaagaag
caaatggaaaaagataacagtgaattagaacagaagatggaaaaggtttttcaagggact
gatgagcagctaaatgacttgtatcacaatcaccagagaactgtaagggagaaagaaagg
cgcttggtagactgtcagcgtgaactggagaagctgagtaaagaagctcggctcctcaac
caggaaagagcagagctgcttgtggagcagggtcgtctacaactacaggcagatcgacat
caagagcatatccgagccagagactcactgattcagtctttggcagcacatcttgaattg
gatggttttgagcgtggaccattcagtgaaagacagattaaaaactttcatgaacttgtg
agagagagacaggagagagaagctaaaactgccagccagctcttgagcgaccttacagac
aaagaagcgctgaagcagagacagatggatgagatgagggacaagaagagcgggctgggg
aggatgattgagctgaagaccgagatcctgacgaagaagcagactgagctgaggaacgtg
aggaatgagctgcagcagctggagggctcctcggacaggattctggagctggaccaggag
ctcacaaaagcggaacgtgaactaagcaaggctgagaaaaatagcagcatagaaacccta
aaagcagaaatactaaacctccaaagtgagaaagcggacctggacaggaacctgcggaaa
ctggatcaggagatggagcagttaaaccatcatacaacaacccgcacacagatggagatg
cttaccaaagacaaaactgacaaagatgaacagatcagaaaaataaagtccaggcacagt
gatgaactaacttcactgttgggatattttcctaacaaaaaacagcttgaagactggctt
cattctaaatccaaagagattaatcagaccagggacagacttgccaaactgaacaaagaa
ctagcttcagccgaacaaaataaaaatcatataaataatgagctaaagaaaaaggaagag
cagctgtctagttatgaagataaactgtttgatgtttgtggtagccaagattttgaaagt
gacttagacagacttaaagaagatattgaaaaatcctcaaagcagcgagccatgctggct
ggagccacagcagtttactcccagttcatcactcagctgacagatgaaaaccagtcctgt
tgcccaggctgtcagagagtatttcagacggaagctgaattacaggaagtcatcagtgac
ttgcagtccaagctgaggcttgctccagataaactcaagtcaacagaatcagaactaaaa
aaaaaagagcggcgccgtgatgaaatgctggggcttgtgcccatgaggcaaagcataatt
gatttgaaggaaaaggaaataccagaattaagaaacagactgcagagtgtcaatagagac
atacagcgcctaaagaatgacatagaggagcaggagacactcttgggtacagtgatgccc
gaagaggaaagtgctaaagtgtgcctgacagacgtcacgatcatggagaggttccagatg
gagctaaaagacgttgaaaggaaaattgcacagcaggcagctaagctgcagggggtagac
ttggatcggactgtccagcaggttaaccaggaaaaacaagaaaaacaacacaaactggat
acagtttccagtaagattgaattgaaccgtaagcttatacaggaccagcaggaacaaatt
cagcacctgaaaagtaaaacaaatgagctgaaatcagagaaactgcagatagccaccaat
ttgcaacggcgtcagcaaatggaggagcagactgtggaattatccactgaagttcagtct
ttgaacagagaaataaaggatgctaaagagcaaataaaccctttggagatagcactggaa
aagttgcagcaggaaaaagaagaattgatccacagaaaaaatacaagtaacaaaatggct
caggataagatcaatgatatcaaagagaaagttaaaaatattcatggttacatgaaagac
atagagaattatattcaagatggaaaagatgactataagaagcaaaaagaaactgaactt
aatgaagttgtcattcaactaaatgaatgtgacaaacacaaagaaaagataaataaagaa
atgggaaccatgaggcaagatattgacacgaagaagatacaggaaaggtggttacaggat
aaccttacactgagaaaaagaagagaggaactaaaagaagttgaagaggaacgaaagcaa
catttgaaggagatgggacagatgcaagttttacagatgaaaaatgagcaccagaagttg
gaagagaacatagacacgataaagagaaatcacagtttggcattggggcgacagaaaggc
tatgaagaagaaattcttcactttaagaaggagctccgagaacctcagtttcgggatgca
gaggagaagtacagagaaatgatgattgtcatgagaaccacagagctggtgaataaggac
ctggacatctactacaaaactcttgatcacgcaataatgaaatttcacagtatgaaaatg
gaagaaatcaacaaaattattcgtgatctttggcggagtacctatcgtgggcaagatatt
gaatacatagaaattcgatccgatgctgatgaaaatgtatcagcttctgataaaaggcga
aattacaactaccgagtggtgatgctgaagggggatacagccttggacatgcgcggacga
tgcagtgctggacagaaggtgctggcctctctcatcatccgactggccctggccgaaacc
ttctgtctgaactgcggcatccttgccttggatgagcctacaacaaacctggaccgagaa
aacatcgagtctctggcacatgctttggttgagattataaaaagtcgctcgcagcagcgc
aacttccagcttctggtcatcactcacgatgaagattttgtggagctcctaggacgatct
gagtatgtggagaaattctacagagtgaagaagaacatcgaccagtgctcagagattgtc
aagagcagcatcaactctctgggctcttatgttcactga

DBGET integrated database retrieval system