KEGG   Rattus norvegicus (rat): 64018Help
Entry
64018             CDS       T01003                                 

Gene name
Slc33a1, Acatn
Definition
(RefSeq) solute carrier family 33 member 1
  KO
K03372  MFS transporter, PAT family, solute carrier family 33 (acetyl-CoA transportor), member 1 [EC:2.3.1.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00604  Glycosphingolipid biosynthesis - ganglio series
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    64018 (Slc33a1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    64018 (Slc33a1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.-  
     64018 (Slc33a1)
Transporters [BR:rno02000]
 Solute Carrier Family (SLC)
  SLC33: Acetyl-CoA transporter
   64018 (Slc33a1)
 Major Facilitator Superfamily (MFS)
  Protein transporters
   Peptide-acetyl-CoA transporter (PAT) [TC:2.A.1.25]
    64018 (Slc33a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acatn
Motif
Other DBs
NCBI-GeneID: 64018
NCBI-ProteinID: NP_071588
RGD: 620653
Ensembl: ENSRNOG00000010023
Vega: OTTRNOG00000001222
UniProt: Q6AYY8
Position
2q31
AA seq 550 aa AA seqDB search
MSPTISHKDNSRQRRSGMFGHALDMKSGPLPPGGWDDNHQDSVGGEGDREVLLGDVGPGD
FPKAKRSYRAELSSILLLLFLYVLQGIPLGLAGSIPLILQSKNVSYTDQAFFSFVFWPFS
LKLLWAPLVDAVYFKNFGRRKSWLVPTQYILGIFMIYLSTQVDRLLGNIDGRTPDVVALT
VTFFLFEFLAATQDIAVDGWALTMLSRENVGYASTCNSVGQTAGYFLGNVLFLALESADF
CNKYLRFQPQPRGIVTLSDFLFFWGTVFLITTTLVALLKKETREASVVKEETQGITDTYK
LLFSIIKMPAVLAFCLLILTSKIGFSAADAVTGLKLVEEGVPKEHLALLAVPMVPLQIIL
PLLISKYTAGPQPLNIFYKAMPYRLLLGLEYALLVWWTPKVEHQGGFPIYYYIIVLLSYA
LHQVTLYSMYVSIMAFNAKVSDPLIGGTYMTLLNTVSNLGGNWPSTVALWLVDPLTVKEC
VGASNQNCRTPEAIELCKKLGGSCVTALDGYYVESIVCVLIGFGWWFFLGPKFKKLQDEG
PSSWKCKRTN
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccgaccatctcccacaaggacaacagtcggcagcggcggtcaggcatgttcggt
cacgctctggatatgaagagtggccccctgccaccgggcggctgggatgacaatcaccaa
gactcggtgggcggggaaggggaccgggaagttcttcttggggatgtcggccctggtgac
ttcccaaaagccaagaggagctatagagccgaactaagtagcattttgttactactcttt
ctttacgtgcttcagggcattcccttaggcctggcggggagcatacccctcattttgcag
agcaaaaatgttagctatacagatcaagctttcttcagttttgtcttctggccattcagt
cttaagctgctctgggctcccttggttgatgccgtctactttaagaacttcggtcgtcgc
aagtcctggcttgtccctactcagtatatactaggaatcttcatgatttatttatccact
caagtggaccgtttgcttggaaatattgatggcagaacaccggatgtagttgctctcact
gtgactttctttttgtttgaattcctggccgccacacaggacatcgctgtggacggttgg
gcattaactatgttatcccgggaaaacgtgggctatgcttcgacatgcaattctgtgggc
caaacagcaggctactttttgggcaatgttttgtttttggctcttgaatctgctgacttt
tgtaacaaatatttgcggtttcagcctcaacccaggggaatcgttaccctttcagatttt
ctatttttctggggaactgtatttttaataacaacaacattagtagcccttctgaaaaaa
gagaccagagaagcgtcagtagtaaaagaagagacacaagggatcacagacacatacaag
ctgctcttctcaattataaaaatgccagcagttctggcgttttgccttctgattctaact
tcaaagattggcttttcagcagcagatgcggtgacaggcctgaaactggtagaagaggga
gtgcctaaggagcacctggccttactggctgtcccaatggtccccctgcagataatcctg
cccctcctcatcagcaagtacacggcaggtccccagcctctgaatatattttacaaagcc
atgccctacagattgttgcttggattagagtacgccctccttgtttggtggactcctaaa
gtagagcatcaaggaggattccctatatattactacatcatagtgctgctgagctatgcc
ttacatcaggtcactctgtacagcatgtatgtgtcaataatggctttcaatgccaaggtc
agtgatcctcttattggaggaacatacatgacccttttaaatactgtgtccaatctggga
ggaaactggccttctacagtggcgctttggctagtggatcccctcacagtgaaggagtgt
gtaggagcttcaaaccagaactgtcggacacctgaggctatcgaactttgcaaaaagctt
ggcggctcgtgcgttacagctctggatggttattatgtggaatccattgtctgtgttctc
attggatttggttggtggttctttcttggtccaaaatttaaaaagttacaggatgaagga
ccgtcctcatggaagtgcaaaaggaccaactga

DBGET integrated database retrieval system