KEGG   Rattus norvegicus (rat): 64023
Entry
64023             CDS       T01003                                 

Gene name
Masp1
Definition
(RefSeq) mannan-binding lectin serine protease 1 precursor
  KO
K03992  mannan-binding lectin serine protease 1 [EC:3.4.21.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05150  Staphylococcus aureus infection
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    64023 (Masp1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    64023 (Masp1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    64023 (Masp1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    64023 (Masp1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     64023 (Masp1)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   64023 (Masp1)
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition EGF_CA CUB_2 Trypsin_2 cEGF Peptidase_S6
Other DBs
NCBI-GeneID: 64023
NCBI-ProteinID: NP_071593
RGD: 620213
Ensembl: ENSRNOG00000001827
UniProt: Q8CHN8
Structure
PDB: 

Position
11
AA seq 704 aa
MRFLSFRRLLLYHVLCLTLTEVSAHTVELNEMFGQIQSPGYPDSYPSDSEVTWNITVPEG
FRVQLYFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMS
VTFRSDFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILH
TDNRTCRVECSGNLFTQRTGTITSPDYPNPYPKSSECSYTIDLEEGFMVTLQFEDIFDIE
DHPEVPCPYDYIKIKAGSKVWGPFCGEKSPEPISTQSHSIQILFRSDNSGENRGWRLSYR
AAGNECPKLQPPVYGKIEPSQAVYSFKDQVLISCDTGYKVLKDNEVMDTFQIECLKDGAW
SNKIPTCKIVDCGVPAVLKHGLVTFSTRNNLTTYKSEIRYSCQQPYYKMLHNTTGVYTCS
AHGTWTNEVLKRSLPTCLPVCGLPKFSRKHISRIFNGRPAQKGTTPWIAMLSQLNGQPFC
GGSLLGSNWVLTAAHCLHHPLDPEEPILHNSHLLSPSDFKIIMGKHWRRRSDEDEQHLHV
KHIMLHPLYNPSTFENDLGLVELSESPRLNDFVMPVCLPEHPSTEGTMVIVSGWGKQFLQ
RLPENLMEIEIPIVNYHTCQEAYTPLGKKVTQDMICAGEKEGGKDACAGDSGGPMVTKDA
ERDQWYLVGVVSWGEDCGKKDRYGVYSYIYPNKDWIQRVTGVRN
NT seq 2115 nt   +upstreamnt  +downstreamnt
atgaggttcctgtctttcagacggctcctcctctaccatgttctgtgcctcaccctgacg
gaggtttcagcccataccgtggagctaaatgaaatgtttggccagatccagtcccctggc
tatccggattcctatccgagtgactcggaggtgacctggaatattactgtcccggagggg
ttccgggtccagctttacttcatgcacttcaacttggaatcctcctacctttgtgaatat
gactatgtgaaggtagaaaccgaagaccaggtgctggcaaccttctgtggcagggagacc
accgataccgagcagaccccgggccaggaagtggttctttcgcctggttcctttatgtct
gtcactttccggtcagatttctccaatgaggaacgattcacaggttttgacgcccactac
atggctgtagatgtggatgagtgcaaggaaagggaagatgaggagctgtcctgtgaccac
tactgccacaactacatcggcggctactactgctcctgtcgctttggctacatcctccac
acagacaacaggacctgccgagtggaatgcagtggcaatctctttacccagaggacaggc
acaatcaccagcccggattaccccaacccttaccccaagagctctgaatgttcctatacc
attgacctggaggagggcttcatggttaccctgcagtttgaggacatttttgacattgaa
gaccatcccgaggtgccctgtccctatgactacattaagattaaagctggttcaaaagta
tggggacccttctgtggagagaaatccccagaaccaatcagcacccagagtcatagcatc
cagatcctatttcgcagcgacaattcaggagagaaccgaggctggaggctctcctacagg
gctgcaggaaatgagtgcccaaagctacaaccccccgtgtatgggaaaattgaaccctcg
caagccgtgtactccttcaaagaccaagtgctcatcagctgtgacacgggctacaaagtg
ctaaaggataacgaggtgatggacacattccaaattgagtgtctgaaggatggtgcatgg
agtaacaagattcccacctgtaaaattgtagactgtggagttccagcagtgctgaaacat
gggctagtaaccttctccacaagaaacaacctcaccacgtacaaatctgagataaggtac
tcctgccagcaaccctattacaagatgcttcacaataccacaggtgtatatacatgttct
gctcatgggacctggacaaatgaagtgctcaagagaagcctgcccacctgccttccagtg
tgtggtctccccaagttctcccggaagcacatctccaggatcttcaatggacgcccagcc
cagaagggtaccactccatggattgccatgctgtcacaactgaatgggcaacccttctgt
gggggtagccttttaggttccaactgggttttgacggctgctcactgtctccaccatcca
cttgatccagaagagccaatcttacacaactcacatttgctcagcccttctgacttcaaa
attatcatgggaaagcactggagacgccgctcagatgaagacgaacagcatctgcatgta
aagcacatcatgctccacccgctgtacaaccccagcacatttgagaacgacttgggtctg
gtggaactgtcagagagtccaaggctgaacgactttgtgatgcctgtctgtctgcctgag
cacccttccactgaaggaaccatggtcatcgtcagcggctgggggaagcagttcctacag
aggcttccagagaacctgatggagattgaaatcccaattgtaaactaccatacctgccaa
gaggcctacaccccattggggaagaaagtgacccaggacatgatctgtgctggagaaaag
gaagggggaaaagacgcctgtgctggcgactctggaggccccatggtgaccaaagatgca
gagagagaccaatggtacctggtgggcgtggtgtcctggggtgaagattgcgggaagaaa
gatcgctatggagtttattcttatatctatcccaacaaggattggatccagagggtcact
ggggtgaggaactga

KEGG   Rattus norvegicus (rat): 64459
Entry
64459             CDS       T01003                                 

Gene name
Masp2
Definition
(RefSeq) mannan-binding lectin serine protease 2 precursor
  KO
K03993  mannan-binding lectin serine protease 2 [EC:3.4.21.104]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno05150  Staphylococcus aureus infection
rno05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    64459 (Masp2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    64459 (Masp2)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    64459 (Masp2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    64459 (Masp2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.104  mannan-binding lectin-associated serine protease-2
     64459 (Masp2)
Peptidases and inhibitors [BR:rno01002]
 Serine peptidases
  Family S1: chymotrypsin family
   64459 (Masp2)
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition EGF_CA EGF CUB_2
Other DBs
NCBI-GeneID: 64459
NCBI-ProteinID: NP_742040
RGD: 620214
Ensembl: ENSRNOG00000011258
UniProt: Q9JJS8 A2VCV7
Structure
PDB: 
5CIS 5CKN 1NT0 5CKM

Position
5
AA seq 685 aa
MRLLIVLGLLWSLVATLLGSKWPEPVFGRLVSPGFPEKYGNHQDRSWTLTAPPGFRLRLY
FTHFNLELSYRCEYDFVKLTSGTKVLATLCGQESTDTERAPGNDTFYSLGPSLKVTFHSD
YSNEKPFTGFEAFYAAEDVDECRTSLGDSVPCDHYCHNYLGGYYCSCRVGYILHQNKHTC
SALCSGQVFTGRSGFLSSPEYPQPYPKLSSCAYNIRLEEGFSITLDFVESFDVEMHPEAQ
CPYDSLKIQTDKREYGPFCGKTLPPRIETDSNKVTITFTTDESGNHTGWKIHYTSTAQPC
PDPTAPPNGHISPVQATYVLKDSFSVFCKTGFELLQGSVPLKSFTAVCQKDGSWDRPIPE
CSIIDCGPPDDLPNGHVDYITGPEVTTYKAVIQYSCEETFYTMSSNGKYVCEADGFWTSS
KGEKSLPVCKPVCGLSTHTSGGRIIGGQPAKPGDFPWQVLLLGETTAAGALIHDDWVLTA
AHAVYGKTEAMSSLDIRMGILKRLSPHYTQAWPEAVFIHEGYTHGAGFDNDIALIKLKNK
VTINRNIMPICLPRKEAASLMKTDFVGTVAGWGLTQKGFLARNLMFVDIPIVDHQKCATA
YTKQPYPGAKVTVNMLCAGLDAGGKDSCRGDSGGALVFLDNETQRWFVGGIVSWGSINCG
GSEQYGVYTKVTNYIPWIENIINNF
NT seq 2058 nt   +upstreamnt  +downstreamnt
atgaggctactgatcgtcctgggtctgctttggagtttggtggccacacttttgggctcc
aagtggcctgagcctgtattcgggcgcctggtgtcccctggcttcccagagaagtatggc
aaccatcaggatcgatcctggacgctgactgcaccccctggcttccgcctgcgcctctac
ttcacccacttcaacctggaactctcttaccgctgcgagtatgactttgtcaagttgacc
tcagggaccaaggtgctagccacgctgtgtgggcaggagagtacagatactgagcgggca
cctggcaatgacaccttctactcactgggtcccagcctaaaggtcaccttccactccgac
tactccaatgagaagccattcacaggatttgaggccttctatgcagcggaggatgtggat
gaatgcagaacatccctgggagactcagtcccttgtgaccattattgccacaactacctg
ggcggctactactgctcctgccgagtgggctacattctgcaccagaacaagcatacctgc
tcagccctttgttcaggccaggtgttcactgggaggtctggctttctcagtagccctgag
tacccacagccataccccaaactctccagctgcgcctacaacatccgcctggaggaaggc
ttcagtatcaccctggacttcgtggagtcctttgatgtggagatgcaccctgaagcccag
tgcccctacgactccctcaagattcaaacagacaagagggaatacggcccgttttgtggg
aagacgctgccccccaggattgaaactgacagcaacaaggtgaccattacctttaccacc
gacgagtcagggaaccacacaggctggaagatacactacacaagcacagcacagccctgc
cctgatccaacggcgccacctaatggtcacatttcacctgtgcaagccacgtatgtcctg
aaggacagcttttctgtcttctgcaagactggcttcgagcttctgcaaggttctgtcccc
ctgaagtcattcactgctgtctgtcagaaagatggatcttgggaccggccgataccagag
tgcagcattattgactgtggccctcccgatgacctacccaatggccacgtggactatatc
acaggccctgaagtgaccacctacaaagctgtgattcagtacagctgtgaagagactttc
tacacaatgagcagcaatggtaaatatgtgtgtgaggctgatggattctggacgagctcc
aaaggagaaaaatccctcccggtttgcaagcctgtctgtggactgtccacacacacttca
ggaggccgtataattggaggacagcctgcaaagcctggtgactttccttggcaagtcttg
ttactgggtgaaactacagcagcaggtgctcttatacatgacgactgggtcctaacagcg
gctcatgctgtatatgggaaaacagaggcgatgtcctccctggacatccgcatgggcatc
ctcaaaaggctctcccctcattacactcaagcctggccagaggctgtctttatccatgaa
ggctacactcacggagctggttttgacaatgatatagcactgattaaactcaagaacaaa
gtcacaatcaacagaaacatcatgccgatttgtctaccaagaaaagaagctgcatcctta
atgaaaacagacttcgttggaactgtggctggctgggggttaacccagaaggggtttctt
gctagaaacctaatgtttgtggacataccaattgttgaccaccaaaaatgtgctactgcg
tatacaaagcagccctacccaggagcaaaagtgactgttaacatgctctgtgctggccta
gacgccggtggcaaggacagctgcagaggtgacagcggaggggcattagtgtttctagac
aatgaaacacagagatggtttgtgggaggaatagtttcctggggttctattaactgtggg
gggtcagaacagtatggggtctacacgaaagtcacgaactatattccctggattgagaac
ataataaataatttctaa

DBGET integrated database retrieval system