KEGG   Rattus norvegicus (rat): 64025Help
Entry
64025             CDS       T01003                                 

Gene name
Cd244, 2B4, Nmrk
Definition
(RefSeq) CD244 molecule
  KO
K06582  natural killer cell receptor 2B4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    64025 (Cd244)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    64025 (Cd244)
CD molecules [BR:rno04090]
 Proteins
  64025 (Cd244)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Receptor_2B4 V-set I-set Ig_2 SLAM Ig_3 Ig_6
Motif
Other DBs
NCBI-GeneID: 64025
NCBI-ProteinID: NP_071595
RGD: 68400
Ensembl: ENSRNOG00000004698
UniProt: Q9JLM2
Position
13q24
AA seq 311 aa AA seqDB search
MLQQTVLLSLFLLLRAHQGQDCADSSEEVLGVSGKPVRLRPSNIQAKHVSIEWKKKTGHQ
QTPQIVTWDTTDNKNFNMCCSDIYGFESENFALSIKSAKLNDSGHYLLEITNQRGIVCTK
NFQMLIFDPVETPHLTVQGTLWANGTCQLSLSCFVPKDDNVSYALYRGSMLISNQRYGTH
WENRTDASSLHTYTCNVSNKASWANHTLTSPQSCQSVPSKFNYLPFMVSIGILVKFFHGA
IDCFCVWNRKRKQSQSIAKESLTIHEYVKNAQVSRDQRGHFRASGSSSDVRGDERGQRES
DRRLFQFINRS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgttgcagcaaactgtcctgttgtcactcttcctgctcctcagagctcatcagggccaa
gattgtgcagattcttctgaagaagtgcttggtgtctcaggaaagcctgtccggctgcgg
ccttccaacatacaagcaaaacatgtttctattgaatggaagaagaagacaggacatcaa
cagactccccagatcgtgacttgggatactacggataacaaaaactttaatatgtgttgt
agtgatatctatggttttgagtctgagaattttgctcttagtatcaagtcagctaagcta
aatgacagtggtcactacctgctggagatcaccaaccaaagaggaatagtgtgcactaaa
aacttccagatgcttatatttgatcctgttgagacacctcacctgactgtccaggggacg
ctctgggctaacgggacttgtcaactgtctttgtcctgctttgtgcccaaggatgacaat
gtaagctatgctttgtacagagggagcatgctgatctcgaatcaaaggtatggcacccac
tgggagaaccggactgatgccagcagcctgcacacatatacctgcaatgttagcaacaag
gccagctgggcaaaccacaccctgacctccccgcagagctgtcagagtgtcccttcgaaa
ttcaattatctgccctttatggtatccatcggtatcctcgtcaaattttttcatggggcc
atcgattgcttctgtgtgtggaataggaagagaaagcagtcacagtccatcgctaaggaa
tctttgaccatacatgaatacgtcaagaacgcacaagtcagcagggaccaacgaggacat
tttagggcctctggatcttcctcagatgttcggggagatgagaggggacaaagagaatcg
gacagacgtcttttccagttcatcaacaggtcttag

DBGET integrated database retrieval system