KEGG   Rattus norvegicus (rat): 64026
Entry
64026             CDS       T01003                                 

Gene name
Casp7
Definition
(RefSeq) caspase-7
  KO
K04397  caspase 7 [EC:3.4.22.60]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04668  TNF signaling pathway
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05133  Pertussis
rno05134  Legionellosis
rno05200  Pathways in cancer
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    64026 (Casp7)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    64026 (Casp7)
   04215 Apoptosis - multiple species
    64026 (Casp7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    64026 (Casp7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    64026 (Casp7)
   05133 Pertussis
    64026 (Casp7)
   05134 Legionellosis
    64026 (Casp7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    64026 (Casp7)
   05022 Pathways of neurodegeneration - multiple diseases
    64026 (Casp7)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    64026 (Casp7)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    64026 (Casp7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    64026 (Casp7)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.60  caspase-7
     64026 (Casp7)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C14: caspase family
   64026 (Casp7)
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 64026
NCBI-ProteinID: NP_071596
RGD: 620944
Ensembl: ENSRNOG00000056216
UniProt: O88550
Position
1
AA seq 303 aa
MTDDQDCAAELEMADSSTEDGVDAKPDRSTIISSLLWKKKKNASMCPVSTTRDRVPTYLY
RMDFEKMGKCIIINNKNFDKATGMDVRNGTDKDAEALFKCFRSLGFEVTVYNDCSCAKMQ
DLLRRASEEDHSNSACFACVLLSHGEENLIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKL
FFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRNPGKGSW
FVQALCSILNEHGKDLEIMQILTRVNDRVARHFESQSDDPRFNEKKQIPCMVSMLTKELY
FGR
NT seq 912 nt   +upstreamnt  +downstreamnt
atgacagacgatcaggactgtgctgcagagctggaaatggcagattcttcgacggaagac
ggagttgacgctaagccagaccgctccaccatcatctcatcccttctctggaagaagaag
aaaaatgcctctatgtgccccgtcagtaccacccgggaccgcgtgcccacttacctgtac
cgtatggacttcgagaagatgggcaaatgtatcatcataaataacaagaacttcgacaaa
gcgacaggtatggatgtccggaatgggacggacaaagacgcagaggccctcttcaagtgc
ttccgaagcctgggttttgaagtgaccgtctataatgactgctcttgcgcaaagatgcag
gatctgcttagacgagcctctgaagaggaccacagcaactcagcctgcttcgcctgcgtc
ctgctgagccacggagaagagaatctgatttatgggaaagacggcgtgacaccgataaag
gatctgacagctcattttaggggagaccgatgcaaaaccctgctagagaaacccaagctc
ttcttcatccaggcgtgccgagggacggagctggatgacgggatccaggctgactcgggg
cctatcaacgacaccgacgctaatccccgctacaagatcccggtggaagctgactttctc
tttgcttactccacggttccaggctattattcgtggaggaacccaggaaagggctcctgg
tttgtgcaggccctctgctccatcctgaatgagcatggcaaggacctggagatcatgcag
atcctgaccagggtgaacgacagggtggccagacacttcgagtcccagtctgatgacccc
cgcttcaatgagaagaagcagattccatgtatggtgtccatgctcaccaaagagctctac
tttggccgttga

DBGET integrated database retrieval system