KEGG   Rattus norvegicus (rat): 64026Help
Entry
64026             CDS       T01003                                 

Gene name
Casp7
Definition
(RefSeq) caspase 7
  KO
K04397  caspase 7 [EC:3.4.22.60]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04668  TNF signaling pathway
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno05010  Alzheimer's disease
rno05133  Pertussis
rno05134  Legionellosis
rno05200  Pathways in cancer
Module
rno_M00685  Apoptotic machinery
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    64026 (Casp7)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    64026 (Casp7)
   04215 Apoptosis - multiple species
    64026 (Casp7)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    64026 (Casp7)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    64026 (Casp7)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    64026 (Casp7)
  Infectious diseases
   05133 Pertussis
    64026 (Casp7)
   05134 Legionellosis
    64026 (Casp7)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.60  caspase-7
     64026 (Casp7)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C14: caspase family
   64026 (Casp7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14
Motif
Other DBs
NCBI-GeneID: 64026
NCBI-ProteinID: NP_071596
RGD: 620944
Ensembl: ENSRNOG00000056216
UniProt: O88550
Position
1q55
AA seq 303 aa AA seqDB search
MTDDQDCAAELEMADSSTEDGVDAKPDRSTIISSLLWKKKKNASMCPVSTTRDRVPTYLY
RMDFEKMGKCIIINNKNFDKATGMDVRNGTDKDAEALFKCFRSLGFEVTVYNDCSCAKMQ
DLLRRASEEDHSNSACFACVLLSHGEENLIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKL
FFIQACRGTELDDGIQADSGPINDTDANPRYKIPVEADFLFAYSTVPGYYSWRNPGKGSW
FVQALCSILNEHGKDLEIMQILTRVNDRVARHFESQSDDPRFNEKKQIPCMVSMLTKELY
FGR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgacagacgatcaggactgtgctgcagagctggaaatggcagattcttcgacggaagac
ggagttgacgctaagccagaccgctccaccatcatctcatcccttctctggaagaagaag
aaaaatgcctctatgtgccccgtcagtaccacccgggaccgcgtgcccacttacctgtac
cgtatggacttcgagaagatgggcaaatgtatcatcataaataacaagaacttcgacaaa
gcgacaggtatggatgtccggaatgggacggacaaagacgcagaggccctcttcaagtgc
ttccgaagcctgggttttgaagtgaccgtctataatgactgctcttgcgcaaagatgcag
gatctgcttagacgagcctctgaagaggaccacagcaactcagcctgcttcgcctgcgtc
ctgctgagccacggagaagagaatctgatttatgggaaagacggcgtgacaccgataaag
gatctgacagctcattttaggggagaccgatgcaaaaccctgctagagaaacccaagctc
ttcttcatccaggcgtgccgagggacggagctggatgacgggatccaggctgactcgggg
cctatcaacgacaccgacgctaatccccgctacaagatcccggtggaagctgactttctc
tttgcttactccacggttccaggctattattcgtggaggaacccaggaaagggctcctgg
tttgtgcaggccctctgctccatcctgaatgagcatggcaaggacctggagatcatgcag
atcctgaccagggtgaacgacagggtggccagacacttcgagtcccagtctgatgacccc
cgcttcaatgagaagaagcagattccatgtatggtgtccatgctcaccaaagagctctac
tttggccgttga

DBGET integrated database retrieval system