KEGG   Rattus norvegicus (rat): 64028Help
Entry
64028             CDS       T01003                                 

Gene name
Tsnax, Trax
Definition
(RefSeq) translin-associated factor X
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Translin
Motif
Other DBs
NCBI-GeneID: 64028
NCBI-ProteinID: NP_071598
RGD: 621574
Ensembl: ENSRNOG00000049784
UniProt: Q9JHB5
Position
19q12
AA seq 290 aa AA seqDB search
MNGKEGPGGFRKRKHDNFPHNQRREGKDASSSSPVMLAFKSFQQELDTRHDKYERLVKLS
RDITVESKRTIFLLHRITSAPDMEEILTESESKLDGVRQKMLQVAQELSGEDMHQFHRAV
TTGLQEYVEAVSFQHFIRTRSLISMEEINRQLTFTTDDSGKESKAPPADGQDKQLVTWRL
KITPVDYLLGVADLTGELMRMCINSVGNGDIDTPFEVSQFLRQVYDGFSFIGNTGPYEVS
KKLYTLKQSLSKVENACYALKVRGSEIPKHMLADVFSVKTEMIDQEESIS
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcaaagagggaccaggagggttcaggaagaggaagcatgataacttcccacat
aaccaaaggagagaagggaaggatgccagttcgtcttcgccggtgatgctggccttcaaa
tcgtttcagcaggagctggacacaagacacgacaaatatgagcgacttgtgaaactaagc
cgggatattaccgtggaaagtaagaggacgatttttcttctccataggatcacaagtgct
cctgatatggaggagattctgactgaatcagaaagtaagctggatggggtcagacagaaa
atgctgcaggtagcccaagagctctcaggagaagacatgcaccagttccatcgtgctgtc
accacaggactccaggaatacgtggaggctgtctcctttcaacacttcatcagaacccga
tccctgatcagtatggaggagatcaacaggcagctgacgtttacaacagacgacagtggg
aaggagagcaaggctcctcccgctgatggacaagacaagcagctggttacctggagactg
aagatcacaccggtggactacctgctgggcgtggccgacttgactggagagctgatgcgg
atgtgcattaacagcgtgggcaacggggacattgacaccccctttgaagtgagccagttc
ctacgccaggtttacgatgggttctccttcattggcaacactgggccctacgaggtctct
aagaagctgtacaccttgaaacagagcctgtccaaagtggagaacgcttgctatgccctt
aaagtccggggctctgagatccctaagcacatgctggccgatgtgttctcagtgaaaacg
gagatgattgaccaggaagagagcatttcttaa

DBGET integrated database retrieval system