KEGG   Rattus norvegicus (rat): 64030
Entry
64030             CDS       T01003                                 

Gene name
Kit
Definition
(RefSeq) KIT proto-oncogene receptor tyrosine kinase
  KO
K05091  proto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04072  Phospholipase D signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04640  Hematopoietic cell lineage
rno04916  Melanogenesis
rno05200  Pathways in cancer
rno05221  Acute myeloid leukemia
rno05224  Breast cancer
rno05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    64030 (Kit)
   04014 Ras signaling pathway
    64030 (Kit)
   04015 Rap1 signaling pathway
    64030 (Kit)
   04072 Phospholipase D signaling pathway
    64030 (Kit)
   04151 PI3K-Akt signaling pathway
    64030 (Kit)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    64030 (Kit)
  09152 Endocrine system
   04916 Melanogenesis
    64030 (Kit)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    64030 (Kit)
   05230 Central carbon metabolism in cancer
    64030 (Kit)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    64030 (Kit)
   05224 Breast cancer
    64030 (Kit)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    64030 (Kit)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:rno04090]
    64030 (Kit)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     64030 (Kit)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   64030 (Kit)
CD molecules [BR:rno04090]
 Proteins
  64030 (Kit)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Ig_5 Ig_6 V-set Pkinase_fungal C1-set APH
Other DBs
NCBI-GeneID: 64030
NCBI-ProteinID: NP_071600
RGD: 620568
Ensembl: ENSRNOG00000002227
Vega: OTTRNOG00000001677
UniProt: Q63116
Position
14p11
AA seq 978 aa
MRGARGAWDLLCVLLVLLRGQTGTSQPSASPGEPSPPSIQPAQSELIVEAGDTIRLTCTD
PAFVKWTFEILDVRIENKQSEWIREKAEATHTGKYTCVSGSGLRSSIYVFVRDPAVLFLV
GLPLFGKEDNDALVRCPLTDPQVSNYSLIECDGKSLPTDLKFVPNPKAGITIKNVKRAYH
RLCIRCAAQREGKWMRSDKFTLKVRAAIKAIPVVSVPETSHLLKEGDTFTVICTIKDVST
SVDSMWIKLNPQPQSKAQVKRNSWHQGDFNYERQETLTISSARVNDSGVFMCYANNTFGS
ANVTTTLKVVEKGFINIFPVKNTTVFVTDGENVDLVVEFEAYPKPEHQQWIYMNRTPTNR
GEDYVKSDNQSNIRYVNELRLTRLKGTEGGTYTFLVSNSDVSASVTFDVYVNTKPEILTY
DRLMNGRLQCVAAGFPEPTIDWYFCTGAEQRCTVPVPPVDVQIQNASVSPFGKLVVQSSI
DSSVFRHNGTVECKASNAVGKSSAFFNFAFKGNSKEQIQPHTLFTPLLIGFVVTAGLMGI
IVMVLAYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAG
AFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLG
ACTVGGPTLVITEYCCYGDLLNFLRRKRDSFIFSKQEEQADAALYKNLLHSKESSCDSSN
EYMDMKPGVSYVVPTKTDKRRSARIDSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKG
MAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIRNDSNYVVKGNARLPVKWMAPE
SIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAAM
YEVMKTCWDADPLKRPTFKQVVQLIEKQISDSSKHIYSNLANCNPNPENPVVVDHSVRVN
SVGSSTSSTQPLLVHEDA
NT seq 2937 nt   +upstreamnt  +downstreamnt
atgagaggcgctcgcggcgcctgggatctgctctgcgtcctgttggtcctgctccgtggc
cagacagggacttctcagccatctgcgagtccaggggagccgtctccaccatccatccag
ccggcccagtcagagttaatagttgaagccggggacaccatcaggctgacgtgcactgac
cccgcctttgtcaaatggactttcgagatcctcgatgtaaggattgagaataagcagagc
gaatggattcgagaaaaagccgaggccactcacacgggcaaatacacgtgcgtcagcggc
agcggcctcaggagctctatttacgtgttcgttagagatcctgccgtacttttcctggtt
ggccttcccttgtttggcaaagaagacaacgacgcactggtccgctgccccctgacagac
ccacaggtgtccaattactccctcattgagtgtgatgggaaatctctccccacggacctg
aagttcgtccccaaccccaaggctggcatcaccatcaaaaacgtgaagcgcgcctaccac
cggctgtgcatccggtgtgctgcccagcgtgagggcaaatggatgcggtctgacaaattc
accctcaaagtgagagcagccatcaaagctatcccagtggtgtctgtgcccgaaacaagt
catctccttaaggaaggggacacatttacggtgatatgcaccataaaagacgtgtctaca
tccgtggactccatgtggataaagttgaaccctcagcctcagagcaaagcccaggtaaag
cgcaatagctggcatcagggcgacttcaattacgaacgccaggagacgctgactatcagc
tcagcaagagttaacgattccggagtgttcatgtgttatgccaataatacttttggatca
gcaaatgtcacaacaaccttgaaagtagtagaaaagggattcatcaacatcttccctgtg
aagaacactacggtatttgtaactgatggggaaaatgtagacttggttgttgagttcgag
gcctaccctaaacctgaacaccagcagtggatctacatgaacaggacgcctactaacaga
ggggaggattatgtcaaatccgacaaccaaagcaacatcagatatgtgaacgaacttcgc
ctgaccagattgaaaggcacagaaggaggcacttacacctttctggtgtccaactctgat
gtcagtgcttccgtgacatttgatgtttatgtgaacacaaaaccagaaatcctgacatat
gacaggctcatgaatggcaggctccagtgtgtggcggcgggattcccggagcccacaata
gattggtatttttgtacaggggcagagcaaaggtgtaccgttcctgtcccgccagtagac
gtacagatccagaatgcgtctgtgtcaccatttggaaaactggtggttcagagttccata
gactccagcgtcttccggcacaacggcacggtggagtgtaaggcctccaacgctgtgggc
aagagctctgccttctttaactttgcatttaaaggtaacagcaaagagcaaatccagccc
cacaccctgttcacgccgctgctcattggcttcgtggtcacagccggcttgatggggatc
attgtgatggttcttgcctacaaatatttgcagaaacccatgtatgaagtacaatggaag
gttgtcgaggagataaatgggaacaattatgtttacatagacccaacgcagcttccttat
gaccacaaatgggagtttcccagaaacaggctgagttttggaaagaccttgggagctggt
gcctttgggaaggtagttgaggccactgcctatggcttaattaagtcggatgccgccatg
acggttgccgtgaagatgctcaaaccaagtgcccatttaacggaaagggaggccctaatg
tcagaactgaaggtcctgagctacctgggtaatcacatgaatatcgtcaacctccttgga
gcgtgtaccgtgggagggcccaccctggtcattacagaatactgttgctatggtgatctt
ttgaatttcttgagaagaaagcgtgactcgtttattttctcaaagcaagaagaacaggca
gacgccgcactttataagaaccttctgcattcaaaggagtcttcctgtgacagctcaaac
gagtacatggacatgaagcctggcgtttcctacgtcgtaccaaccaagacagacaaaagg
agatccgcaagaatagactcgtatatagaaagagacgtgactcccgccatcatggaagat
gacgagctggctctggacctggaagatttgctgagcttttcctaccaggtggccaagggc
atggcgttcctcgcctccaagaactgtattcacagagatttggcagccaggaatatcctc
ctcactcacgggcggatcacaaagatttgcgatttcggcctagccagagacatcaggaat
gattcgaattacgtggtaaaaggaaatgcacggctgcccgtgaagtggatggcaccggag
agcattttcaactgcgtgtacacatttgaaagtgacgtctggtcctatgggattttcctc
tgggagctattctctctaggaagcagcccctacccagggatgccggtcgattccaagttt
tacaagatgatcaaggaaggtttccgaatgctcagccctgagcacgcgcctgccgcaatg
tatgaagttatgaagacttgctgggatgctgatcccctgaaaaggccaacattcaagcag
gttgttcagctcattgagaagcagatctcagacagcagcaaacatatttactccaactta
gcaaactgtaaccccaacccagagaaccccgtggtggtggaccattctgtgagggtcaat
tccgtcggcagcagcacctcttccacacagcctctcctcgtgcatgaggacgcctga

DBGET integrated database retrieval system