KEGG   Rattus norvegicus (rat): 64032Help
Entry
64032             CDS       T01003                                 

Gene name
Ctgf, CTGRP
Definition
(RefSeq) connective tissue growth factor
  KO
K06827  connective tissue growth factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04371  Apelin signaling pathway
rno04390  Hippo signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    64032 (Ctgf)
   04371 Apelin signaling pathway
    64032 (Ctgf)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    64032 (Ctgf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cys_knot IGFBP VWC TSP_1
Motif
Other DBs
NCBI-GeneID: 64032
NCBI-ProteinID: NP_071602
RGD: 621392
Ensembl: ENSRNOG00000015036
UniProt: Q9R1E9
Position
1p12
AA seq 347 aa AA seqDB search
MLASVAGPVSLALVLLLCTRPATGQDCSAQCQCAAEAAPRCPAGVSLVLDGCGCCRVCAK
QLGELCTERDPCDPHKGLFCDFGSPANRKIGVCTAKDGAPCVFGGSVYRSGESFQSSCKY
QCTCLDGAVGCVPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDEPKDRTVVGPALAAY
RLEDTFGPDPTMMRANCLVQTTEWSACSKTCGMGISTRVTNDNTFCRLEKQSRLCMVRPC
EADLEENIKKGKKCIRTPKIAKPVKFELSGCTSVKTYRAKFCGVCTDGRCCTPHRTTTLP
VEFKCPDGEIMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMA
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcctccgtcgcgggtcccgttagcctcgccttggtgctcctcctctgcacccgg
cctgccaccggccaggactgcagcgcgcagtgtcagtgcgcagctgaagcggcgccgcgc
tgccccgccggcgtgagcctggtgctggacggctgcggctgctgccgcgtctgcgccaag
cagctgggagaactgtgcacggagcgtgatccctgcgacccacacaagggtctcttctgc
gacttcggctcccccgccaaccgcaagattggcgtgtgcactgccaaagatggtgcaccc
tgtgtcttcggtgggtccgtgtaccgcagcggcgagtccttccaaagcagttgcaaatac
cagtgcacttgcctggatggggccgtgggctgtgtgcccctgtgcagcatggacgtgcgc
ctgcccagccctgactgccccttcccgagaagggtcaagctgcccgggaaatgctgtgag
gagtgggtgtgtgatgagcccaaggaccgcacagtggttggccctgccctagctgcctac
cgactggaagacacatttggccctgacccaactatgatgcgagccaactgcctggtccag
accacagagtggagcgcctgttctaagacctgtgggatgggcatctccacccgggttacc
aatgacaataccttctgcaggctggagaagcagagtcgtctctgcatggtcaggccctgt
gaagctgacctagaggaaaacattaagaagggcaaaaagtgcatccggacgcctaaaatt
gccaagcctgtcaagtttgagctttctggctgcaccagtgtgaagacctaccgggctaag
ttctgtggggtgtgcacggacggccgctgctgcacaccgcacagaaccaccacactgccg
gtggagttcaagtgccccgatggcgagatcatgaaaaagaacatgatgttcatcaagacc
tgtgcctgccattacaactgtcccggggacaatgacatctttgagtccttgtactacagg
aagatgtatggagacatggcgtaa

DBGET integrated database retrieval system