KEGG   Rattus norvegicus (rat): 64035Help
Entry
64035             CDS       T01003                                 

Gene name
Pygl
Definition
(RefSeq) glycogen phosphorylase L
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00500  Starch and sucrose metabolism
rno01100  Metabolic pathways
rno04217  Necroptosis
rno04910  Insulin signaling pathway
rno04922  Glucagon signaling pathway
rno04931  Insulin resistance
Module
rno_M00855  Glycogen degradation, glycogen => glucose-6P
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    64035 (Pygl)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    64035 (Pygl)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    64035 (Pygl)
   04922 Glucagon signaling pathway
    64035 (Pygl)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    64035 (Pygl)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     64035 (Pygl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphorylase DUF4181
Motif
Other DBs
NCBI-GeneID: 64035
NCBI-ProteinID: NP_071604
RGD: 620687
Ensembl: ENSRNOG00000006388
UniProt: P09811
Position
6q24
AA seq 850 aa AA seqDB search
MAKPLTDQEKRRQISIRGIVGVENVAELKKGFNRHLHFTLVKDRNVATPRDYYFALAHTV
RDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDM
EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIREGWQVEEA
DDWLRHGNPWEKARPEFMLPVHFYGRVEHTQAGTKWVDTQVVLALPYDTPVPGYMNNTVN
TMRLWSARAPNDFNLQDFNVGDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDVIRRFKASKFGSKDGVGTVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKL
PWSKAWEITKKTFAYTNHTVLPEALERWPVDLVEKLLPRHLQIIYEINQKHLDRIVALFP
KDIDRMRRMSLIEEEGGKRINMAHLCIVGCHAVNGVAKIHSDIVKTQVFKDFSELEPDKF
QNKTNGITPRRWLLLCNPGLADLIAEKIGEDYVKDLSQLTKLHSFVGDDIFLREIAKVKQ
ENKLKFSQFLEKEYKVKINPSSMFDVHVKRIHEYKRQLLNCLHVITMYNRIKKDPKKFFV
PRTVIIGGKAAPGYHMAKMIIKLVTSVAEVVNNDPMVGSKLKVIFLENYRVSLAEKVIPA
TDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRVDDVA
ALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPNQPDLFKDIINMLFYHDRFKVFADYEA
YVKCQEKVSQLYMNQKAWNTMVLRNIAASGKFSSDRTIREYAKDIWNMEPSDLKISLSKE
SSNGVNANGK
NT seq 2553 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcccttgaccgaccaggaaaagcgacggcagatcagcatccgcggcatcgtg
ggcgtggagaacgtagcggagctgaaaaagggcttcaatcgtcacctgcacttcactctg
gtcaaggaccgcaatgtggccaccccccgcgactactacttcgcccttgcgcacacagtg
cgcgaccacctggtggggcgctggatccgcacacagcagcactactatgacaagtgcccc
aagagggtgtattacctctctctggaattttacatgggccgaacattacagaacaccatg
atcaaccttggcttacagaatgcctgcgacgaagctatttaccagctcgggctggacatg
gaggagttggaagaaattgaagaagatgctgggcttggcaatggtggtcttgggaggctt
gctgcctgcttcttggactccatggcaacgctggggcttgcagcctatggatacggcatc
cgttatgaatatggaatcttcaatcagaagatccgagaagggtggcaggtagaggaggca
gatgactggctcaggcatggaaacccttgggagaaggctcgtcctgaattcatgctgcct
gtgcatttctacggaagagtagagcacacccaggcaggaacaaagtgggtcgacacccag
gtggtgctggctttgccgtacgacacccccgtacctgggtatatgaacaacacggtgaac
actatgcgcctctggtcggcccgagcacccaatgactttaaccttcaagactttaatgtc
ggagactacattcaggctgtgctggaccggaacctggctgagaatatctccagagtgctg
taccccaacgataacttttttgaagggaaggagctgaggctgaagcaggagtactttgtg
gtggctgcgaccctgcaggatgtcatccgacgtttcaaggcctccaagttcggctccaag
gatggtgtaggaaccgtgtttgatgcttttccagatcaggtagccatccagctgaatgac
acacatcccgcactcgccatcccggagctgatgaggatctttgtggacattgaaaaattg
ccctggtccaaggcctgggagatcaccaagaagacctttgcctacaccaaccacacggtg
ctcccggaggccctggagcgctggccagtggacctggtggagaagctgctgcctcgacac
ttgcagatcatttatgagatcaatcagaagcatttagatagaatcgtggccctgtttcct
aaagacatcgaccgcatgcggcggatgtctctcatcgaagaggaaggaggcaaaaggatc
aacatggcccacctctgcatcgtgggctgccacgcggtgaacggggtagcgaagatccac
tcggacatcgtgaagacccaagtattcaaggacttcagtgagctagaaccagacaagttc
cagaataaaaccaacgggatcaccccgaggcgctggctcttactctgcaacccagggctg
gctgacttgatagcagagaaaattggagaagactatgtgaaagacctgagccagctgacg
aagctccacagcttcgtgggcgacgacatcttcctccgggaaatagccaaagtgaagcag
gaaaataaactgaaattctcccagttcctggaaaaggagtacaaggtgaagatcaaccca
tcttccatgtttgacgtgcacgtgaagcggatccacgagtacaaacgacagcttctgaac
tgcctgcatgtgatcaccatgtacaatcgcatcaagaaagaccctaagaagttcttcgtg
ccaaggacagtcataattggtgggaaagctgccccaggatatcacatggccaaaatgatc
ataaagctggtcacctccgtggcagaagtggtgaacaacgaccctatggttggcagcaag
ttgaaagtcatcttcttggagaactacagagtgtctcttgctgaaaaagtcattccagcc
acggacctgtcagaacagatctccactgctggcacggaagcctcggggacgggcaacatg
aagttcatgctgaacggggccctgaccatcgggactatggatggggccaatgtggagatg
gcggaggaggccggggaggaaaacctgttcatctttggcatgagggtagatgatgtggcc
gctctggacaagaaagggtatgaggccaaagaatattatgaggcccttccagaactgaag
ctggtcattgaccaaattgacaatggcttcttttctcccaatcagccagacctcttcaaa
gacatcatcaacatgttattttatcatgacagatttaaagtctttgcagactacgaagcc
tatgtcaagtgtcaagaaaaagtcagtcagctgtatatgaatcaaaaagcctggaacaca
atggttctcagaaacatagctgcctcggggaagttctccagtgaccgaacaatcagggag
tatgccaaggacatctggaacatggagccttccgatctgaagatctccctatctaaggag
tccagcaatggggtcaacgccaatgggaagtaa

DBGET integrated database retrieval system