KEGG   Rattus norvegicus (rat): 64036
Entry
64036             CDS       T01003                                 

Gene name
Cd55
Definition
(RefSeq) complement decay-accelerating factor precursor
  KO
K04006  decay accelerating factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04610  Complement and coagulation cascades
rno04640  Hematopoietic cell lineage
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    64036 (Cd55)
   04610 Complement and coagulation cascades
    64036 (Cd55)
 09160 Human Diseases
  09166 Cardiovascular disease
   05416 Viral myocarditis
    64036 (Cd55)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    64036 (Cd55)
   04090 CD molecules [BR:rno04090]
    64036 (Cd55)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    64036 (Cd55)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   64036 (Cd55)
  Exosomal proteins of other body fluids (saliva and urine)
   64036 (Cd55)
  Exosomal proteins of colorectal cancer cells
   64036 (Cd55)
CD molecules [BR:rno04090]
 Proteins
  64036 (Cd55)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Antigens
  64036 (Cd55)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 64036
NCBI-ProteinID: NP_071605
RGD: 620651
Ensembl: ENSRNOG00000003927
UniProt: Q9Z0M0
Position
13
AA seq 399 aa
MIRTRAPGTRAPPPPPLLLSLSLLLLLLSPTVSGDCGPPPDIPNATPNSGKHTKFAHQSQ
VTYSCNKGFKQIPDKPNTVVCLENDQWSNYETFCNKTCSAPLRLNYASLKKEYRNMNFFP
IGTTVEFECRPGFQKVTSRTGKSTCLEELVWSPVVEFCKKRACPNPRELKNGHINIPTDI
LFGSEIIFSCDKGYKLVGVTSTFCSITGNAVDWDDVFPVCTTIFCPDPPKINNGRIREES
DSYAYRQSVTYSCDQGFILVGNSSVHCTLNGEVGEWSSAPPKCIERHKVPTKTPPEVDIP
STMPHESTLINFPSTRAPLSHKPTTVKVPGTRVKPTSHKPTEVKVPATQHVPVSKTTVRH
PTRTSKDRGESNSGGDHFIYGHTCLITMTILHVMLLLTG
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgatccgcacgcgggcgccggggactcgggcaccgccgccgccgccgctgctgctgtcg
ctgtcgctgctgctgctgctgctgtccccgactgtaagcggagactgcggcccacctcca
gacattcctaatgccacgccaaactcgggtaaacacaccaagtttgcccaccaaagccaa
gtgacatattcgtgtaataagggcttcaaacaaattccagacaagccaaacacagtggtc
tgccttgaaaatgaccaatggtctaactacgaaactttctgtaataaaacctgtagtgct
ccactgagactgaattatgcatccctcaaaaaggagtatcgtaacatgaattttttccca
attggcaccactgtggaatttgagtgtcggccaggatttcaaaaagtaacttcacgcaca
ggaaaatcaacttgccttgaggaattagtatggtctccagttgttgaattttgtaaaaaa
agagcatgccctaatcctagagaactgaaaaatggtcacatcaacataccaactgacata
ttattcggatcagaaataatcttctcatgcgacaaagggtacaagctggtcggtgtaact
tctacattctgttctattacggggaatgctgtggactgggatgacgtatttccagtgtgc
acaacaattttttgtccagacccaccaaaaatcaataatggaagaattcgagaggaaagc
gactcctacgcatatagacagtcggtgacctattcctgtgaccaaggcttcattctggtt
ggaaattcttccgttcattgtactctgaacggtgaagtaggagaatggagtagtgcacca
cccaagtgcatagagagacacaaggtcccaactaagaccccaccagaagttgatattcca
agtacaatgcctcatgaatccaccttaattaattttccaagtacaagagccccactgtct
cataaacccactacagttaaagttccaggtacaagagtcaaaccaacgtctcacaagccc
actgaagttaaagttccagcaacacagcatgtacctgtttccaagacaacggtacgtcat
ccaacgagaacatctaaagacagaggagagtctaattcaggtggtgaccattttatatat
ggacatacatgtttaataaccatgacaattttgcatgtgatgctcttactcactggctag

DBGET integrated database retrieval system