KEGG   Rattus norvegicus (rat): 64044Help
Entry
64044             CDS       T01003                                 

Gene name
Casp8, CASP-8
Definition
(RefSeq) caspase 8
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno04115  p53 signaling pathway
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04217  Necroptosis
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno04932  Non-alcoholic fatty liver disease (NAFLD)
rno05010  Alzheimer disease
rno05016  Huntington disease
rno05134  Legionellosis
rno05142  Chagas disease (American trypanosomiasis)
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    64044 (Casp8)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    64044 (Casp8)
   04215 Apoptosis - multiple species
    64044 (Casp8)
   04217 Necroptosis
    64044 (Casp8)
   04115 p53 signaling pathway
    64044 (Casp8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    64044 (Casp8)
   04621 NOD-like receptor signaling pathway
    64044 (Casp8)
   04622 RIG-I-like receptor signaling pathway
    64044 (Casp8)
   04625 C-type lectin receptor signaling pathway
    64044 (Casp8)
   04657 IL-17 signaling pathway
    64044 (Casp8)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    64044 (Casp8)
   05203 Viral carcinogenesis
    64044 (Casp8)
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    64044 (Casp8)
   05016 Huntington disease
    64044 (Casp8)
  09166 Cardiovascular diseases
   05416 Viral myocarditis
    64044 (Casp8)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    64044 (Casp8)
  09171 Infectious diseases: Bacterial
   05134 Legionellosis
    64044 (Casp8)
   05152 Tuberculosis
    64044 (Casp8)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    64044 (Casp8)
   05161 Hepatitis B
    64044 (Casp8)
   05160 Hepatitis C
    64044 (Casp8)
   05168 Herpes simplex infection
    64044 (Casp8)
   05163 Human cytomegalovirus infection
    64044 (Casp8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    64044 (Casp8)
   05169 Epstein-Barr virus infection
    64044 (Casp8)
   05165 Human papillomavirus infection
    64044 (Casp8)
  09174 Infectious diseases: Parasitic
   05145 Toxoplasmosis
    64044 (Casp8)
   05142 Chagas disease (American trypanosomiasis)
    64044 (Casp8)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    64044 (Casp8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rno01002]
    64044 (Casp8)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     64044 (Casp8)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C14: caspase family
   64044 (Casp8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 DED PYRIN MukF_C
Motif
Other DBs
NCBI-GeneID: 64044
NCBI-ProteinID: NP_071613
RGD: 620945
Ensembl: ENSRNOG00000012331
UniProt: Q9JHX4
Position
9q31
AA seq 482 aa AA seqDB search
MDFHSCLYDIAERLGNEELAALKFLCLDHIPQKKQESINDVLVLFQRLQEEGMLEEDNLS
FLKELLFHISRRDLLSRVLKSSPEEMVRELQVLGKAQVSAYRVMLFKLSEDMDKEDLKSF
KFLLITEIPKCKLQDNSSLLDIFVEMEKRTILAENNLVTLKSICFRVNRSLLGRIDDYER
SSTERRMSTEGGEELPVSVLDEVTIKMQDMWDSPGEQESESLNSDNVYQMKSKPRGYCLI
FNNNNFSKAREDIPKLSNMRDRKGTNYDEEALSKTFKELHFEIVSFSDCTASQIHEVLVS
YQSKDHKGKDCFICCILSHGDKGIVYGTDGKEASIYELTSYFTGSKCPSLAGKPKIFFIQ
ACQGNNFQKAVPVPDETGLEQEHVLEEDSSSYKNYIPDEADFLLGMATVKNCVSYRDPTR
GTWYIQSLCQSLRERCPRGEDILSILTGVNYDVSNKDNPRNMGKQMPQPIFTLRKKLFFP
PN
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggatttccacagttgtctttacgatattgctgaacgtctgggcaacgaagaactggct
gccctcaagttcctgtgcttggaccacatcccgcagaagaagcaggagtccatcaatgat
gtcctggtgctatttcagaggctgcaggaagaggggatgttggaggaagacaatttgtcc
ttcctgaaggagctgcttttccatatcagtcggcgggatctgctgagcagagtcctaaaa
agcagcccagaggaaatggtgagggagctgcaggttctgggcaaagcccaggtttctgcc
tacagggttatgctctttaagctctcagaagacatggacaaggaggatttgaaatctttt
aagttccttttgatcactgagatccctaaatgtaaactgcaagacaactcgagcctgctt
gatattttcgtagagatggagaagaggactatcctggcagaaaacaacttggttacccta
aaatcaatctgtttccgggtcaacaggagcttgctgggaaggatcgacgattacgaacga
tcaagcacagagagaagaatgagcactgaaggaggggaagagctgccagtttctgttttg
gatgaggtgaccatcaaaatgcaggacatgtgggactcgccaggagagcaagagagtgag
tcactaaattcagacaacgtttaccaaatgaagagcaaacctcgggggtactgtctgatc
ttcaacaataataatttcagcaaagcacgggaggacatacccaaactcagcaacatgcgg
gacagaaaaggaaccaactatgatgaagaggctctgagtaagacctttaaggagcttcat
tttgagatcgtgtccttcagtgattgcacagcaagtcaaatccatgaggttctagtatcc
tatcaaagcaaggaccacaagggcaaagactgcttcatctgctgcatcctatcacatggg
gacaagggcatcgtctacggaacggatgggaaggaagcctctatctatgagctgacatct
tacttcactggctcaaagtgcccttccctggctggaaaacccaaaatcttttttattcaa
gcttgtcaaggaaataacttccagaaagcggtgcctgtgcctgatgagacaggcttagaa
caggagcacgttttagaagaggattcatcatcttacaagaactatatcccagatgaggca
gactttctgctggggatggctactgtgaaaaactgtgtttcctaccgagatcccacgcgt
gggacctggtatatccagtcactttgccagagcctgagggaaagatgtcctcgaggtgag
gatattctcagcatcctgactggcgtgaactatgatgtgagcaataaagacaacccgagg
aacatgggaaagcagatgccacagcccatcttcacactacggaagaagctcttcttccct
cctaactga

DBGET integrated database retrieval system