KEGG   Rattus norvegicus (rat): 64044
Entry
64044             CDS       T01003                                 

Gene name
Casp8
Definition
(RefSeq) caspase-8
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01524  Platinum drug resistance
rno04115  p53 signaling pathway
rno04210  Apoptosis
rno04215  Apoptosis - multiple species
rno04217  Necroptosis
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04668  TNF signaling pathway
rno04932  Non-alcoholic fatty liver disease
rno05010  Alzheimer disease
rno05016  Huntington disease
rno05022  Pathways of neurodegeneration - multiple diseases
rno05132  Salmonella infection
rno05134  Legionellosis
rno05142  Chagas disease
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05161  Hepatitis B
rno05162  Measles
rno05163  Human cytomegalovirus infection
rno05164  Influenza A
rno05165  Human papillomavirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
rno05203  Viral carcinogenesis
rno05416  Viral myocarditis
rno05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    64044 (Casp8)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    64044 (Casp8)
   04215 Apoptosis - multiple species
    64044 (Casp8)
   04217 Necroptosis
    64044 (Casp8)
   04115 p53 signaling pathway
    64044 (Casp8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    64044 (Casp8)
   04621 NOD-like receptor signaling pathway
    64044 (Casp8)
   04622 RIG-I-like receptor signaling pathway
    64044 (Casp8)
   04625 C-type lectin receptor signaling pathway
    64044 (Casp8)
   04657 IL-17 signaling pathway
    64044 (Casp8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    64044 (Casp8)
   05203 Viral carcinogenesis
    64044 (Casp8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    64044 (Casp8)
   05161 Hepatitis B
    64044 (Casp8)
   05160 Hepatitis C
    64044 (Casp8)
   05164 Influenza A
    64044 (Casp8)
   05162 Measles
    64044 (Casp8)
   05168 Herpes simplex virus 1 infection
    64044 (Casp8)
   05163 Human cytomegalovirus infection
    64044 (Casp8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    64044 (Casp8)
   05169 Epstein-Barr virus infection
    64044 (Casp8)
   05165 Human papillomavirus infection
    64044 (Casp8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    64044 (Casp8)
   05134 Legionellosis
    64044 (Casp8)
   05152 Tuberculosis
    64044 (Casp8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    64044 (Casp8)
   05142 Chagas disease
    64044 (Casp8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    64044 (Casp8)
   05016 Huntington disease
    64044 (Casp8)
   05022 Pathways of neurodegeneration - multiple diseases
    64044 (Casp8)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    64044 (Casp8)
   05416 Viral myocarditis
    64044 (Casp8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    64044 (Casp8)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    64044 (Casp8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    64044 (Casp8)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     64044 (Casp8)
Peptidases and inhibitors [BR:rno01002]
 Cysteine peptidases
  Family C14: caspase family
   64044 (Casp8)
SSDB
Motif
Pfam: DED Peptidase_C14 PYRIN MukF_C
Other DBs
NCBI-GeneID: 64044
NCBI-ProteinID: NP_071613
RGD: 620945
Ensembl: ENSRNOG00000012331
UniProt: Q9JHX4
Position
9
AA seq 482 aa
MDFHSCLYDIAERLGNEELAALKFLCLDHIPQKKQESINDVLVLFQRLQEEGMLEEDNLS
FLKELLFHISRRDLLSRVLKSSPEEMVRELQVLGKAQVSAYRVMLFKLSEDMDKEDLKSF
KFLLITEIPKCKLQDNSSLLDIFVEMEKRTILAENNLVTLKSICFRVNRSLLGRIDDYER
SSTERRMSTEGGEELPVSVLDEVTIKMQDMWDSPGEQESESLNSDNVYQMKSKPRGYCLI
FNNNNFSKAREDIPKLSNMRDRKGTNYDEEALSKTFKELHFEIVSFSDCTASQIHEVLVS
YQSKDHKGKDCFICCILSHGDKGIVYGTDGKEASIYELTSYFTGSKCPSLAGKPKIFFIQ
ACQGNNFQKAVPVPDETGLEQEHVLEEDSSSYKNYIPDEADFLLGMATVKNCVSYRDPTR
GTWYIQSLCQSLRERCPRGEDILSILTGVNYDVSNKDNPRNMGKQMPQPIFTLRKKLFFP
PN
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggatttccacagttgtctttacgatattgctgaacgtctgggcaacgaagaactggct
gccctcaagttcctgtgcttggaccacatcccgcagaagaagcaggagtccatcaatgat
gtcctggtgctatttcagaggctgcaggaagaggggatgttggaggaagacaatttgtcc
ttcctgaaggagctgcttttccatatcagtcggcgggatctgctgagcagagtcctaaaa
agcagcccagaggaaatggtgagggagctgcaggttctgggcaaagcccaggtttctgcc
tacagggttatgctctttaagctctcagaagacatggacaaggaggatttgaaatctttt
aagttccttttgatcactgagatccctaaatgtaaactgcaagacaactcgagcctgctt
gatattttcgtagagatggagaagaggactatcctggcagaaaacaacttggttacccta
aaatcaatctgtttccgggtcaacaggagcttgctgggaaggatcgacgattacgaacga
tcaagcacagagagaagaatgagcactgaaggaggggaagagctgccagtttctgttttg
gatgaggtgaccatcaaaatgcaggacatgtgggactcgccaggagagcaagagagtgag
tcactaaattcagacaacgtttaccaaatgaagagcaaacctcgggggtactgtctgatc
ttcaacaataataatttcagcaaagcacgggaggacatacccaaactcagcaacatgcgg
gacagaaaaggaaccaactatgatgaagaggctctgagtaagacctttaaggagcttcat
tttgagatcgtgtccttcagtgattgcacagcaagtcaaatccatgaggttctagtatcc
tatcaaagcaaggaccacaagggcaaagactgcttcatctgctgcatcctatcacatggg
gacaagggcatcgtctacggaacggatgggaaggaagcctctatctatgagctgacatct
tacttcactggctcaaagtgcccttccctggctggaaaacccaaaatcttttttattcaa
gcttgtcaaggaaataacttccagaaagcggtgcctgtgcctgatgagacaggcttagaa
caggagcacgttttagaagaggattcatcatcttacaagaactatatcccagatgaggca
gactttctgctggggatggctactgtgaaaaactgtgtttcctaccgagatcccacgcgt
gggacctggtatatccagtcactttgccagagcctgagggaaagatgtcctcgaggtgag
gatattctcagcatcctgactggcgtgaactatgatgtgagcaataaagacaacccgagg
aacatgggaaagcagatgccacagcccatcttcacactacggaagaagctcttcttccct
cctaactga

DBGET integrated database retrieval system