KEGG   Rattus norvegicus (rat): 64046
Entry
64046             CDS       T01003                                 

Gene name
Mre11
Definition
(RefSeq) double-strand break repair protein MRE11
  KO
K10865  double-strand break repair protein MRE11
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03440  Homologous recombination
rno03450  Non-homologous end-joining
rno04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    64046 (Mre11)
   03450 Non-homologous end-joining
    64046 (Mre11)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    64046 (Mre11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rno03032]
    64046 (Mre11)
   03400 DNA repair and recombination proteins [BR:rno03400]
    64046 (Mre11)
DNA replication proteins [BR:rno03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    MRN complex
     64046 (Mre11)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     64046 (Mre11)
    BRCA1-C complex
     64046 (Mre11)
   NHEJ (non-homologous end-joining)
    MRX complex
     64046 (Mre11)
SSDB
Motif
Pfam: Mre11_DNA_bind Metallophos
Other DBs
NCBI-GeneID: 64046
NCBI-ProteinID: NP_071615
RGD: 69263
Ensembl: ENSRNOG00000009506
UniProt: Q9JIM0
Position
8
AA seq 706 aa
MSPTDPLDDEDTFKILVATDIHLGFMEKDAVRGNDTFVTFDEILRLALENEVDFILLGGD
LFHENKPSRKTLHSCLELLRKYCMGDRPVQFEIISDQSVNFGFSKFPWVNYRDGNLNISI
PVFSIHGNHDDPTGADALCALDVLSCAGFVNHFGRSMSVEKVDISPVLLQKGSTKLALYG
LGSIPDERLYRMFVNKKVTMLRPKEDENSWFNLFVIHQNRSKHGSTNFIPEQFLDDFIDL
VIWGHEHECKIGPTRNEQQLFYVSQPGSSVVTALSPGETVKKHVGLLRVKGRKMNMQKLP
LRTVRQFFMEDVVLANHPSLFNPDNPKVTQAIQSFCLEKIEEMLDSAERERLGNPQQPEK
PLIRLRVDYSGGFEPFNVLRFSQKFVDRVANPKDVIHFFRHREQKGKTGEEINFGKLIIK
PASEGTTLRVEDLVKQYFQTAEKNVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKYQLE
KTQRFLKERHIDALEDKIDEEVRRFRESRQRNTNEEDDEVREAMSRARALRSQSENAASA
FSADDLSFDITEQTADDSDDSQSAVPSRGRGRGRGRRGGRGQSTAPRGGSQRGRDTGLGI
STRGRSSKATASTSRNMSIIDAFRSTRQQPSRNVATKNYSETIEVDESDDDDSFPTSSRA
DQRWSGTAPSKRMSQSQTAKGVDFESDEDDDDDPFMSGSCPRRNRR
NT seq 2121 nt   +upstreamnt  +downstreamnt
atgagccccacagatccgcttgatgatgaagacacatttaaaatcctggttgccactgat
attcatcttggatttatggaaaaagatgcagttagaggaaatgacacatttgtgacattt
gatgaaattttaagacttgccctggaaaatgaagtggattttattttgttaggtggtgat
cttttccatgaaaacaagccctcaaggaaaaccctgcacagctgcttagagctgcttagg
aagtactgtatgggtgaccgccctgtgcaatttgagatcatcagtgaccagtcagtcaac
tttggttttagtaagtttccatgggtgaactaccgggatggcaatctcaacatctccatt
ccagtgtttagtatccacggcaaccatgatgatcccacaggggcagatgccctctgtgcc
ctggatgttttaagctgtgctgggtttgtgaatcactttggacggtcaatgtctgtggag
aaggttgacattagtccagttctgctgcagaaaggaagcacaaaactcgctctgtacggc
ttagggtccattccagatgaaaggctctatcggatgtttgtcaataagaaagtaacgatg
ttgaggcctaaggaagacgagaactcatggtttaacttattcgtgattcatcagaacagg
agtaaacacggaagcaccaacttcatcccagagcagtttttggatgacttcattgacctg
gtcatctggggccatgaacatgagtgtaaaatcggcccaaccaggaatgagcagcagctc
ttctatgtgtctcagcccggaagctcggtggtgacagccctttcccctggagaaactgtg
aagaaacatgtaggcctgctacgcgttaaagggagaaagatgaacatgcagaagctgcct
ctccgcacagtgcgacagttcttcatggaagatgtggtcctggctaaccacccaagcctg
ttcaaccctgacaatcctaaggtgacccaggccatccagagcttctgtttggagaagatt
gaagaaatgcttgacagtgctgagcgggaacggctggggaatcctcagcagccggagaag
cctctcatccgactacgggtggactacagtggaggctttgaacctttcaacgttcttcgt
tttagccagaagtttgtggatcgggttgctaacccaaaagatgtcatccactttttcaga
cacagggaacaaaaaggaaaaacaggagaagagatcaactttgggaagctcatcataaaa
cctgcttcagaagggacgacgctcagagtagaagaccttgtaaagcagtatttccaaact
gcagagaagaatgttcagctctcactgctgacagaaagagggatgggtgaagcagttcaa
gagtttgtggacaaggaagagaaagatgccatcgaggaattagtgaagtaccagttggag
aaaacgcagcggtttcttaaggagcgccacatcgatgctctagaagacaagattgatgaa
gaggtccggcgtttcagagaaagcagacagagaaataccaacgaagaagacgatgaagtt
cgagaggccatgagcagggcccgggccctcaggtcacagtcggagaacgccgcctcagcc
ttcagtgcagatgacctgagttttgatataacagagcagacagcagatgactctgacgat
agccagtcagcagtgccgagccgaggccgaggtcgaggccgaggacgaagaggaggcaga
gggcagagcactgcacccagaggaggctctcagagaggccgagacactgggctggggatc
tctactcggggcaggagctcaaaggccactgcgtcaacatctagaaatatgtccattata
gatgctttcagatctacccgacagcagccttccagaaatgtagccactaagaattactca
gagaccattgaggtggatgaatctgatgacgatgacagttttcctaccagctccagggct
gatcaaaggtggtcgggcacagcacctagcaaacggatgtcccagagccagacagccaaa
ggggtggactttgaatcagacgaggacgatgacgacgaccctttcatgagtggtagttgc
ccaagaagaaaccgaagataa

DBGET integrated database retrieval system