KEGG   Rattus norvegicus (rat): 64047Help
Entry
64047             CDS       T01003                                 

Gene name
Lrat
Definition
(RefSeq) lecithin-retinol acyltransferase (phosphatidylcholine-retinol-O-acyltransferase)
  KO
K00678  phosphatidylcholine-retinol O-acyltransferase [EC:2.3.1.135]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00830  Retinol metabolism
rno04977  Vitamin digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    64047 (Lrat)
 09150 Organismal Systems
  09154 Digestive system
   04977 Vitamin digestion and absorption
    64047 (Lrat)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.135  phosphatidylcholine---retinol O-acyltransferase
     64047 (Lrat)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRAT NLPC_P60
Motif
Other DBs
NCBI-GeneID: 64047
NCBI-ProteinID: NP_071616
RGD: 68362
Ensembl: ENSRNOG00000025608
UniProt: Q9JI61
Position
2q34
AA seq 231 aa AA seqDB search
MKNSMLEAASLLLEKLLLISNFKIFSVCAPGGGTGKKHPYEINSFLRGDVLEVSRTHFTH
YGIYLGDNRVAHLMPDILLALTSDKERTQKVVSNKRLLPGVICKVASIRVDTVEDFAYGA
DILVNHLDETLKKKSLLNEEVARRAEQQLGLTPYSLLWNNCEHFVTYCRYGSPISPQAEK
FHETVKILIRDQRSCLASAVLGLVSIIYTGLASYMTLPAVCIPFCLWMMSG
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaagaactcaatgctggaggctgcgtccctccttctggagaagctgctccttatttcc
aacttcaagatctttagcgtgtgcgccccgggaggaggcacagggaagaaacatccctat
gaaatcaactcttttctccggggtgacgtgttggaagtgtcacggacccattttacccac
tatgggatctacctgggggacaaccgtgtcgcccatctaatgcctgacatcctgttggcc
ctgaccagtgacaaggaacgcactcagaaggtggtctccaacaagcgtctcctcccagga
gtcatttgcaaggtggccagcatccgtgtggacacagtagaggactttgcctatggagcg
gacatcctcgtcaatcacctagacgagactctcaagaagaagtccttgctcaatgaggag
gtggcacgcagagcagagcagcagttggggctgaccccctacagcctactgtggaacaac
tgcgaacactttgtgacctactgcagatacggctctcctatcagtccgcaggctgagaag
tttcacgagactgtgaagatactcattcgtgatcagagaagttgtcttgcttcagctgtc
ttgggattagtgtctattatctacacaggcctggcatcatatatgacccttcctgcagtc
tgcatcccgttctgcttgtggatgatgtctggctag

DBGET integrated database retrieval system