KEGG   Rattus norvegicus (rat): 64060
Entry
64060             CDS       T01003                                 

Gene name
Vps33b
Definition
(RefSeq) VPS33B, late endosome and lysosome associated
  KO
K23281  vacuolar protein sorting-associated protein 33B
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    64060 (Vps33b)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Others
   Others
    64060 (Vps33b)
SSDB
Motif
Pfam: Sec1
Other DBs
NCBI-GeneID: 64060
NCBI-ProteinID: NP_071622
RGD: 620644
Ensembl: ENSRNOG00000013149
UniProt: Q63616
Position
1q31
AA seq 617 aa
MAFPHRLDAPELPDFSMLKRLARDQLIYLLEQLPGKKDLFIEADLMSPLDRIANVSILKQ
HEVDKLYKVENKLTLSSNEQLCFLVRPRIKTMRYIANLVNADKLAGRVRKYKIILSPQKF
YACEMVLEEEGVYGDVSCDEWAFSLLPLDVDLLSMELPEFFRDYFLEGDQRWINTVAQAL
HLLSTLYGPFPNCYGIGRCTKMSYDLWRKLEEEEDSETKGRRPEIGHIFLLDRDVDFVTA
LCSQVVYEGLVDDTFRIKCGSVDFGPEVTSSDKSLKVLLNAEDKVFSEIRNEHFSNVFGF
LSQKARNLQAQYDRRRGMDIKQMKNFVSQELKGLKQEHRLLSLHIGACESIMKKKTKQDF
QELIKTEHALLEGFNIRESTSYIEEHIDRQVSPIESLRLMCLLSITENGLIPKDYRSLKT
QYLQSYGPEHLLTFSNLRRAGLLTEQASGDTLTAVENKVSKLVTDKAAGKITDAFSSLAK
RSNFRAISKKLNLIPRVDGEYDLKVPRDMAYVFSGAYVPLSCRIIEQVLDRRSWQGLDEV
VRLLNCSDFAFTDMAKEDKASSESLRLILVVFLGGCTFSEISALRFLGREKGYRFIFLTT
AVTNSARLMEAMSEVKS
NT seq 1854 nt   +upstreamnt  +downstreamnt
atggctttcccccatcgactggacgcccctgagcttcccgacttctctatgctcaagagg
ctggctcgggaccagctcatctatctgctagaacagcttcctgggaaaaaggatttgttc
attgaggcagatctcatgagccctttggatcgaattgctaacgtctctatcctgaagcaa
catgaagtagacaagctgtacaaggtggaaaacaaacttactctcagctccaatgaacaa
ttgtgcttcttggtcagacctcgaatcaagactatgcgctacattgccaatcttgtcaat
gctgacaaactggctggccgagttagaaaatacaaaatcatcttaagtcctcagaagttt
tatgcatgtgagatggtgcttgaggaagagggagtctatggagatgtgagctgtgatgaa
tgggccttttctctgctgcctcttgatgtggatctgctgagcatggaactgccagaattt
ttcagggattacttcctggaaggggatcagcgttggatcaacacggtggctcaggccttg
caccttctcagtactctctatgggcccttccctaactgctatggcattggcagatgcacg
aagatgtcatatgacctgtggaggaaactggaggaggaagaggacagtgaaacgaaaggt
cggagaccagagattggacacatctttctcttggacagagatgtggactttgtgacagca
ctttgctcccaagtggtttatgagggcttggtagatgacaccttccgaatcaagtgtgga
agtgtcgactttggcccagaagtcacatcctctgacaagagcctgaaggtgctgctcaac
gctgaggacaaggtgttcagtgagatccgcaatgagcacttctccaatgtctttggcttc
ttgagccagaaagcccggaacttgcaggctcaatatgaccgccggagaggtatggacata
aagcagatgaagaacttcgtgtcccaagagctcaagggactgaaacaggagcaccgcctt
ctgagtctccatattggagcttgtgaatcaatcatgaagaagaaaaccaagcaggacttc
caggagctaatcaagaccgagcatgcactgctggagggcttcaacattcgagagagcact
agctacattgaagaacacatagaccggcaggtgtcgcccatagaaagcctacgcctcatg
tgccttttgtccatcactgagaatggtttgattcccaaggattatcggtccctgaaaaca
cagtatctgcagagctacggccccgagcacctgctaaccttctccaaccttcggagagcc
gggcttctaacagagcaggcttcgggggacaccctcactgcagtagagaataaagtgagc
aagctggtgactgacaaggccgcaggaaaaatcactgatgccttcagttctctggccaag
aggagcaattttcgtgccatcagcaaaaagctgaatttgatcccacgtgtagatggggag
tatgacctgaaagtgccccgggacatggcttacgtcttcagtggcgcctacgtgcctctg
agctgccgaatcattgagcaggtgctggaccggcggagttggcagggcctagatgaagtg
gtccggctgctaaactgcagtgactttgcattcacagacatggctaaggaagacaaggct
tccagtgagtcactccgcctcatcttggtggtgttcttggggggctgcacgttctcagag
atatcagccctgcgcttcctgggtagagagaaagggtacagatttatttttctgacaact
gctgttacaaacagtgctcgcctcatggaagccatgagtgaggtgaaatcctga

DBGET integrated database retrieval system