KEGG   Rattus norvegicus (rat): 64086
Entry
64086             CDS       T01003                                 

Gene name
Csnk1g1
Definition
(RefSeq) casein kinase 1, gamma 1
  KO
K08958  casein kinase 1, gamma [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    64086 (Csnk1g1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    64086 (Csnk1g1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     64086 (Csnk1g1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CK1 group
  CK1 family [OT]
   64086 (Csnk1g1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal CK1gamma_C PIP49_C
Other DBs
NCBI-GeneID: 64086
NCBI-ProteinID: NP_071624
RGD: 621404
Ensembl: ENSRNOG00000016620
UniProt: Q62761
Position
8q24
AA seq 390 aa
MDHSNREKDDRQRTTKTMAQRNTHCSRPSGTSTSSGVLMVGPNFRVGKKIGCGNFGELRL
GKNLYTNEYVAIKLEPIKSRAPQLHLEYRFYKQLGSAGEGLPQVYYFGPCGKYNAMVLEL
LGPSLEDLFDLCDRTFTLKTVLMIAIQLLSRMEYVHSKNLIYRDVKPENFLIGRQGNKKE
HVIHIIDFGLAKEYIDPETKKHIPYREHKSLTGTARYMSINTHLGKEQSRRDDLEALGHM
FMYFLRGSLPWQGLKADTLKERYQKIGDTKRSTPIEALCENFPEEMMTYLRYVRRLDFFE
KPDYEYLRNLFTDLFERKGYTFDYAYDWVGRPIPTPVGSVHVDSGASAITRESHTHRDRP
SQQQPLRNQPRSLTAEWFVLAPLSHPPAPT
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggaccattctaatagagaaaaggatgatagacaacggacaactaaaaccatggcacaa
aggaatacacactgttcccgaccatctggcacttcaacatcctctggggttctcatggtg
ggacccaacttcagggttggcaagaagatagggtgtgggaacttcggagagctcagatta
ggtaaaaatctctacaccaatgaatatgtagccattaaactggaaccaataaaatcacgt
gctccacaacttcatttagagtacaggttttataaacagctcggcagtgcaggtgaaggt
ctcccacaggtttattactttggaccatgtgggaagtacaatgccatggtgctggaactc
ctcggccctagcttggaagacttgtttgacctctgtgaccgaacgtttactttgaagacg
gtgttaatgatagccatccagttgctttctcgaatggagtatgtacactcaaagaatctc
atttaccgagatgtcaaaccagagaacttcttaattggccgacaaggcaataagaaagag
catgtaatacacattatagattttggactggccaaggaatacattgatcctgaaaccaaa
aaacacataccttacagagagcacaaaagcttaactggaactgcgcgatacatgtctatc
aacacacatctaggcaaagagcaaagccggcgggatgatttggaagccctgggccatatg
ttcatgtacttccttcgaggcagcctaccctggcaaggactcaaggctgatacattaaaa
gagagatatcagaaaattggtgataccaaaaggagtactcccatcgaagctctctgtgag
aactttccagaggagatgatgacctaccttcgatatgtcaggagattagacttctttgaa
aaacctgattatgagtatttacggaacctcttcacagatctgtttgaacggaaaggctat
acttttgactatgcctatgattgggttggaaggcctattcctactccagtaggatcagtt
catgtagattctggtgcatctgcaataactcgagaaagccacacacacagggatcgacca
tcacaacaacagcctcttagaaatcagccaagatctttaacagcagagtggtttgtgctg
gctcccctttcccaccctccagcacccacataa

DBGET integrated database retrieval system