KEGG   Rattus norvegicus (rat): 64152
Entry
64152             CDS       T01003                                 

Gene name
Chp1, Chp, Wrch2
Definition
(RefSeq) calcineurin-like EF-hand protein 1
  KO
K17610  calcineurin B homologous protein 1
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    64152 (Chp1)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     64152 (Chp1)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 SPARC_Ca_bdg RST
Other DBs
NCBI-GeneID: 64152
NCBI-ProteinID: NP_077053
RGD: 620447
Ensembl: ENSRNOG00000004742
UniProt: P61023
Structure
PDB: 
2CT9

Position
3q35
AA seq 195 aa
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFSEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFR
LYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL
EKVDVEQKMSIRFLH
NT seq 588 nt   +upstreamnt  +downstreamnt
atggggtctcgggcctccacgttactgcgggacgaagagctcgaggagatcaagaaggag
actggcttttcccacagtcagatcacacgcctgtacagccgcttcaccagcctggacaaa
ggggagaacggaactctcagccgggaagatttccagaggattccagaacttgccatcaac
ccactgggggaccggatcatcaatgccttcttctcagagggagaggatcaggtaaacttc
cgaggattcatgagaactttggctcatttccgacccattgaggataacgaaaagagcaaa
gatgtgaatggaccggaacccctcaacagccggagcaacaaactgcactttgctttcaga
ctttatgacttggataaagatgacaagatctcccgcgatgagctgttacaggtactgcga
atgatggtcggagtgaatatctcagatgagcagctgggcagtattgcagacaggaccatc
caggaggctgaccaagatggagacagtgccatatcttttacagaatttgttaaggttttg
gagaaggtggatgtagaacagaagatgagcatccgatttcttcactaa

DBGET integrated database retrieval system