KEGG   Rattus norvegicus (rat): 641528Help
Entry
641528            CDS       T01003                                 

Gene name
Dtnbp1
Definition
(RefSeq) dystrobrevin binding protein 1
  KO
K20189  dysbindin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    641528 (Dtnbp1)
Membrane trafficking [BR:rno04131]
 Endosome - Lysosome transport
  Others
   BLOC-1 complex
    641528 (Dtnbp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dysbindin DUF2730 SIM_C Sec34 Peptidase_S46
Motif
Other DBs
NCBI-GeneID: 641528
NCBI-ProteinID: NP_001032753
RGD: 1590759
UniProt: Q5M834
Position
17p14
AA seq 352 aa AA seqDB search
MLETLRERLLSVQQDFTSGLKTLSDKSKEAKVKSRPRTAPYLPKYSAGLDLLSRYEDTWA
ALHRRAKECADAGELVDSEVVMLSAHWEKKRTSLAELQEQLQQLPALLQDVESLMASLAH
LETSFEEVENHLLHLEDLCGQCELERHKQAHARHLEDYKKSKRKELEAFKAELDTEHAQK
ILEMEHTQQLKLKERQKFFEEAFQQDMEQYLSTGHLQIAERREPMGSMSSMEVNVDVLEQ
MDLMDLSDQEALDVFLNSGGEDNTVISPGLEMESNPSQNEMNLQIPNPSESASQPPASPS
ACTDLDTADAPLIQADEEEVQVDTALVTLNTDRKSTPGVSDDSDQCDSTQDI
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgctggagaccctgcgcgagcggctgctgagcgtgcagcaggatttcacctccgggcta
aagacgttaagcgacaagtcaaaagaagcaaaagtaaaaagcagacccaggactgctccc
tacttaccaaagtactctgctggactggacttacttagcaggtatgaggatacgtgggct
gcacttcacagaagagccaaggaatgtgcagacgctggcgagctggtggacagcgaggtg
gtcatgctgtctgcccactgggagaagaagaggaccagcctggccgagctgcaggagcag
ctgcagcagctgccagctctcctccaggacgtggagtccttgatggcaagcctggctcat
ttagagacgagttttgaagaggtagaaaaccatctgttgcatctggaggacttgtgtggg
cagtgtgagttagaaagacataaacaggcccatgcccgacacctggaggattacaagaaa
agtaagaggaaggagcttgaagccttcaaagctgaactcgatacagaacacgcacagaag
atcctggaaatggagcacacccagcagctgaagctgaaggagcggcagaagttcttcgag
gaggctttccagcaggacatggagcaatacctgtccacaggtcacctgcagattgcagag
aggcgagagcccatgggcagcatgtcctccatggaagtgaatgtggacgtgctggagcag
atggacctgatggacctctctgaccaggaggcgctcgatgtcttcttgaactctggcgga
gaggacaatactgtgatatcccctggtttggagatggaatccaaccccagtcagaatgaa
atgaatcttcagattccaaatccctcagaatcagcgtcccagccacctgcctcaccctct
gcctgcactgacctggacactgctgatgctcccctcatccaggctgatgaagaggaggta
caagtggacacggccttggtcacattaaacactgacagaaagtccaccccaggtgtcagt
gatgacagtgaccagtgtgactcaactcaggacatttaa

DBGET integrated database retrieval system