KEGG   Rattus norvegicus (rat): 64155Help
Entry
64155             CDS       T01003                                 

Gene name
Scn7a, Na-G, Scn6a
Definition
(RefSeq) sodium voltage-gated channel alpha subunit 7
  KO
K04839  voltage-gated sodium channel type VII alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    64155 (Scn7a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    64155 (Scn7a)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   64155 (Scn7a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Na_trans_assoc GPHH IQ
Motif
Other DBs
NCBI-GeneID: 64155
NCBI-ProteinID: NP_113874
RGD: 61922
Ensembl: ENSRNOG00000029342
UniProt: P97706
Position
3q21
AA seq 1702 aa AA seqDB search
MLTSPEPKGLVPFTAESLELIKNHIAKKCNEEHEEEDLKPSRDIEAGKKLPFAYGTLPQG
TVSEPLEDVDPYYYVKRNTFMVLNRNRVIFRFNAVSILCTLSPLSSLRRAVIKVLVHPLL
RLLILISVLTDSILMCMSNLPEWILAVENTCLGIYTFEILVKVIARGIWAGSFSFLGDLW
NWLDFSVTLFELITRSSPLSSLPMFKTIRTLRILKIIPLNHGLQSIVVTLVQCLKKLLGA
IALALFFLTVSSLFGMGLFMGNLKHKCVRWPQEDGNDVMYSGTGSQYHILERENFYYMEG
ARYALLCGNKTDAGLCPEGYMCVKEGSNPDNGFTSFDNFGWALLAMFRLMTQDYPELLYH
QILYASGKIYMIFFVLISFWFAFYMASLFLGILTMAYEQEKQRASEESRDMDSKCHQTVK
EFEEEHEGAELQCIWFYEEVLDLLGLELCIKEMETTQIEMKKRSPTSINTTLDILEDTAL
GHKEEPETSRKECPLCWYKFTKTCFIWKCSPCWIKLNEFADRIITHPLFDLFLVICIILN
ICFLALEHFPMSEELMSLLAIGNLVFIGIYTIEMILKIIAMHPYGYFQISWHIFDSILVV
LGLTEMLLADIEEITVFILVPLIFIKLGKYAPPFKNLMRILGRALVALKDLVLLVSIFIY
FSAVFGMKLFGRSYKDCVCHVDQDCQRQRWHMSDFLHAYVTVFRILCGEWIETLWECMEV
AGEAWCIPFYMMVILIGNLLILYLFVGLVSSFASYDATTEVSKEAKNLQLAVAWIKMVIN
CVLLKILCKEKTVSTEATDQTCDPSVKENISGHTLSELSNTQTFLRYKDQSSGTEKTPVT
ESESQSLIASPSVSETVPIASGESDIENLDNKETRSKSANGSSKEKMKQSSSSECSTVDI
AISEEEEMVYEHEKSKLHKNGYERKSSAGQVSRESRNGKIWRNIRKTCCKIVENSWFECF
IGLVTLLCTGTLALEDIYIHQRKTIKIFLEYGDMIFAYIFILEMLLKWVAYGFKAYFSNN
WYKLDFMVVIVLCLSLKGKTREDLNPLPSIKFLRALRVLSQFERMKVVLRALIKTTLPAV
SVFLVCLMIWLLFSVMGVFLFAGKFYECIDPTRGERFSVFEVMNKSQCENLVFNESMPWE
NAKLNFDNVGNGFLSLFQVATFNGWISIMNSAIDSVGVYMQPSFEHSLHMYTYFIIFVVF
GLFLPLCMLIGVIIRNFNKQKIKQGGSNIFITVKQKKQYRALKKLLYADSQKPAARPRNK
FQGFICDVVTHRVFNVVVVLLICFQATTIMIQNDEQSPQIETAVFWMNSLFTMLFTLECI
LKLTAFRCHYFTSAWNVHDFMVVVFSITGLLLPLSIGQYFVPPSLVQLLLLSRIIHVLRP
GKGPKVFHDLMLPLMLSLPALLNIGLLIFLVMFIYAIFGMYNFAYVKKEAGINDVSNFET
FGSSMLCLFQVTTFSGWDGMLDAIFNSQWSDCDPDKINPGTQVRGDCGSPSVGIFYFVSY
ILISWLIIVNMYVVLIMEFLSIPSKRKNRTLSEDDFRRFFKVWNRFDPDRTQYIDSTKLS
DFAAALDPPLFMAKPNKGQLVAMDLPMAAGDRIHCLDILLAFTKRVMGKDERVEKILSEI
ESGFMLANPFKITYEPITTTLKRKQEAVSATIIQRAYKSYRLRQSDKKIQDIPEIDDGRE
DPNSKGVHSGQIEEKASIQTQI
NT seq 5109 nt NT seq  +upstreamnt  +downstreamnt
atgttgacttccccagagccgaagggccttgtcccattcacggcagagtcacttgaactt
ataaaaaatcacattgctaaaaaatgcaacgaagagcatgaagaagaagatttaaaacca
agccgggatatagaagcaggcaaaaaacttccatttgcctatggaacccttcctcaagga
accgtgtcagagcccttggaagatgtggatccatactactatgttaagagaaatactttc
atggtcttaaacagaaacagagtcatcttcaggttcaatgcggtttccatcctctgcacg
ttgtctcctttaagctctctcagaagagctgttatcaaggttttggtgcacccccttttg
cgcctgctgattttaattagtgttctcaccgacagcatacttatgtgcatgagtaaccta
ccggaatggatattggcagtagagaatacttgcttgggaatttacacattcgaaatactg
gtaaaagtcattgcaagaggtatctgggcagggtcattttccttccttggggatctttgg
aactggcttgatttcagtgtaactttgttcgagcttatcacaaggtcttcacctctaagc
tcccttccaatgtttaaaacaataagaaccttgcgaattttgaagatcatccctttgaac
catggcctgcagtctattgtggtgacgctggtccagtgtttgaagaaactactcggagcc
attgccctagctctgttttttctgactgtgtcttcgctattcgggatgggtctcttcatg
ggcaacctgaagcacaaatgtgtgcgatggccccaagaagatggaaatgatgtgatgtac
agtggaactggaagccagtaccatattctagaaagagaaaacttctactatatggaaggc
gcgagatacgctctcctctgcggcaacaagacagatgccggcctgtgtccagaaggttat
atgtgtgtaaaagagggctcaaatcctgacaatggcttcacaagttttgacaattttggc
tgggctctactggctatgtttcgattgatgactcaggattaccctgaattactttatcac
cagatcctttatgcttcaggaaagatctacatgatattttttgttctgatcagtttctgg
tttgccttctatatggcaagtttgttcttgggcatcctcactatggcctatgaacaggag
aagcagagagcttctgaggagtctagagacatggattctaaatgtcatcagactgtgaaa
gaattcgaggaagaacatgaaggagctgagcttcagtgtatctggttttatgaggaggtt
cttgatctacttggacttgagctttgtatcaaggagatggaaactacacaaatagaaatg
aagaaaagatcaccaacttctataaacaccacattggatatactggaagacactgccctt
ggacacaaagaagaaccagaaacatccaggaaggaatgcccactctgttggtataagttt
actaaaacctgctttatctggaaatgctctccctgttggataaaactgaatgagtttgct
gacagaattataacacacccattgtttgatcttttccttgttatatgcatcattttaaac
atatgcttcctggccctagaacactttccaatgagtgaggagctcatgtcactccttgcc
attggaaacttggtttttattggaatttacacaatagaaatgattttgaagataatcgct
atgcatccatatgggtatttccaaataagctggcatatttttgacagtattcttgtggtt
ttgggattaacagaaatgttactagcagatattgaagaaataactgtttttatattagtc
ccattgatatttataaaattgggaaaatatgcaccaccatttaagaatttgatgcgtatt
cttggtagagcattggtggccctgaaagacttggtcctgttggtctccattttcatttac
ttctctgccgtgtttggcatgaagctgtttggtcgaagttacaaagattgtgtctgccac
gtagatcaagactgtcaacgccaacgttggcacatgagtgacttcctccacgcctacgtg
actgtgttccgaatcctctgcggagagtggatagagacattatgggagtgtatggaggtt
gcaggcgaggcctggtgtattccattttacatgatggtcattttaattggaaatttattg
atactttacctctttgtgggattggtgagctcatttgcttcatacgatgctaccacagaa
gtgagcaaagaagccaaaaaccttcagcttgcagtggcatggataaaaatggtaataaac
tgtgtgcttcttaaaatactgtgcaaagaaaaaactgtttctacagaagcaacagaccaa
acatgtgatccaagtgttaaagagaatatttctggtcatactctttctgaactgagcaac
acccaaacattcctcagatacaaggaccagagcagtggtactgagaaaactccagtgact
gagtctgagagccaatccctgattgctagtcccagtgtatcagaaactgtgccaattgct
tcaggagaatccgatatagaaaacctggataacaaggagactcggagcaagtctgcaaat
ggaagcagtaaagagaaaatgaagcaatctagttcatctgagtgcagcacggttgatatt
gctatttctgaagaagaagaaatggtctatgaacatgaaaagtcgaagcttcataaaaat
ggttatgaacgcaaatcttcagctggccaagtcagtagagaatctaggaatggaaagatt
tggaggaacataaggaaaacttgctgcaagatagtggagaacagctggtttgagtgtttc
attggcctggtcactctgctctgcacaggcactctggctctggaagacatatatattcat
cagcggaaaaccattaaaatcttcctggagtatggagacatgatatttgcttacatcttc
attctggagatgcttctcaagtgggtggcctacggctttaaagcctacttctctaacaac
tggtacaagctggacttcatggtcgttatcgtgttgtgtcttagcttaaaaggcaaaact
cgagaggacctgaaccctctgccttccataaagttccttcgagcacttagagttctgtct
cagtttgaaagaatgaaggtggttctgagagctttgataaaaacaaccttacccgctgtg
agcgtgtttctggtctgcctaatgatctggctgcttttcagtgttatgggagtgttctta
ttcgctggcaagttctatgaatgcattgacccaacaaggggagaaagattctctgtattt
gaagttatgaataagagtcagtgtgaaaacctggtatttaatgaatcaatgccatgggag
aatgcaaaactgaactttgataatgttggaaatggttttctttctttgttccaagtggca
acatttaatgggtggatcagtattatgaattcagcaattgactctgttggtgtgtacatg
cagcctagttttgagcacagcctccacatgtacacttactttatcatctttgttgtgttt
ggattatttcttcccttgtgtatgctgattggtgttattatcaggaatttcaacaagcag
aaaattaagcagggaggatcaaatatctttataacggtaaagcagaagaagcagtaccgg
gcactgaagaagctcttgtatgcagactctcagaaaccagcagcccgccctagaaacaag
ttccaaggcttcatttgtgacgtagtaacacatcgtgtctttaatgtcgtcgtcgtactt
cttatctgtttccaagcaacaaccattatgatacaaaatgatgagcagagtccacaaatt
gaaaccgctgtcttctggatgaactccctttttaccatgctgttcactctggaatgcata
ctgaagctcaccgccttccgctgccactatttcaccagcgcatggaatgttcatgacttt
atggtggtcgttttctccattacaggactgctgctgcctttgtcaataggacaatacttt
gtgcctccttcactggtgcagctgcttcttctctctcgcatcatccatgtcctgcgtcct
gggaaaggaccaaaggtgttccatgatctgatgcttcccttgatgctgtcactcccagca
ctgctcaacattggtcttctcatcttcctggtcatgttcatctacgccatctttggaatg
tacaacttcgcctacgtgaagaaagaagccggaattaatgatgtgtccaactttgagacc
tttggaagcagtatgctttgtctctttcaagttacaacattttctggttgggacgggatg
ctggatgcaattttcaacagtcagtggtctgactgcgatcctgataaaattaacccaggg
actcaggtcaggggagactgtgggagcccttctgttgggattttttattttgtcagttac
atcctcatatcatggttgatcattgttaatatgtacgttgttttgatcatggagttctta
agtattccttctaagagaaaaaacaggaccttgagcgaagatgactttaggagattcttc
aaggtatggaacaggtttgaccctgacaggacccagtacatagactctactaagctttct
gattttgcagctgctctcgatcctcctcttttcatggcaaaaccaaacaagggccagctt
gtagccatggatctccccatggctgcaggagacagaatccattgccttgatattttgctt
gcctttacgaaaagagtgatgggaaaggatgagcgggtggagaagatcctttcagagata
gaatctgggtttatgttagcgaaccctttcaaaattacgtatgagccgattacaacgact
ttgaaacgcaaacaagaggcagtctcagccactatcatccagcgggcatacaaaagttac
cgcttaaggcaaagtgacaaaaagatacaagatatcccggaaatagatgatggcagggag
gatcctaactctaaaggtgtccactctggtcaaatcgaggaaaaggcatctattcagacc
cagatctaa

DBGET integrated database retrieval system