KEGG   Rattus norvegicus (rat): 64155
Entry
64155             CDS       T01003                                 

Gene name
Scn7a
Definition
(RefSeq) sodium channel protein type 7 subunit alpha
  KO
K04839  voltage-gated sodium channel type VII alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    64155 (Scn7a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    64155 (Scn7a)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   64155 (Scn7a)
SSDB
Motif
Pfam: Ion_trans Na_trans_assoc GPHH IQ
Other DBs
NCBI-GeneID: 64155
NCBI-ProteinID: NP_001375437
RGD: 61922
Ensembl: ENSRNOG00000029342
Position
3
AA seq 1680 aa
MLTSPEPKGLVPFTAESLELIKNHIAKKCNEEHEEEDLKPSWGLEAGKKLPFAYGTLPQG
TVSEPLEDVDPYYYVKRNTFMVLNRNRVIFRFNAVSILCTLSPLSSLRRAVIKVLVHPLF
RLLILISVLTDSILMCMSNLPEWILAVENTLLGIYTFEILVKVIARGIWAGSFSFLGDLW
NWLDFSVTLFELITRSSPLSSLPMFKTIRTLRILKIIPLNHGLQSIVVTLVQCLKKLLGA
IALALFFLTVSSLFGMGLFMGNLKHKCVRWPQEDGNDVMYNGTGSQYHILERENFYYMEG
ARYALLCGNKTDAGLCPEGYMCVKEGSNPDNGFTSFDNFGWALLAMFRLMTQDYPELLYH
QILYASGKIYMIFFVLISFWFAFYMASLFLGILTMAYEQEKQRASEESRDMDSKCHQTVK
EFEEEHEGAEMETTQIEMKKRSPTSINTTLDILEDTALGHKEEPETSRKECPLCWYKFTK
TCFIWKCSPCWIKLNEFADRIITHPLFDLFLVICIILNICFLALEHFPMSEELMSLLAIG
NLVFIGIYTIEMILKIIAMHPYGYFQISWHIFDSILVVLGLTEMLLADIEEITVFILVPL
IFIKLGKYAPPFKNLMRILGRALVALKDLVLLVSIFIYFSAVFGMKLFGRSYKDCVCHVD
QDCQRQRWHMSDFLHAYVTVFRILCGEWIETLWECMEVAGEAWCIPFYMMVILIGNLLIL
YLFVALVSSFASYDATTEVSKEAKNLQLAVAWIKMVINCVLLKILCKEKTVSTEATDQTC
DPSVKENISGHTLSELSNTQTFLRYKDQSSGTEKTPVTESESQSLIASPSVSETVPIASG
ESDIENLDNKETRSKSANGSSKEKMKQSSSSECSTVDIAISEEEEMVYEHEKSKLHKNGY
ERKSSAGQVSRESRNGKIWRNIRKTCCKIVENSWFECFIGLVTLLCTGTLALEDIYIDQR
KTIKIFLEYGDMIFAYIFILEMLLKWVAYGFKAYFSNNWYKLDFMVVIVLCLSLIGKTRE
DLNPLASIKFLRALRVLSQFERMKVVLRALIKTTLPAVSVFLVCLMIWLLFSVMGVFLFA
GKFYECIDPTRGERFSVFEVMNKSQCENLVFNESMPWENAKLNFDNVGNGFLSLFQVATF
NGWISIMNSAIDSVGVYMQPSFEHSLHMYTYFIIFVVFGLFLPLCMLIGVIIRNFNKQKI
KQGGSNIFITVKQKKQYRALKKLLYADSQKPAARPRNKFQGFICDVVTHRVFNVIIILLI
CFQATTIMIQNDEQSPQIETAVFWMNSLFTMLFTLECILKLTAFRCHYFTSAWNVHDFMV
VVFSITGLLLPLSIGQYFVPPSLVQLLLLSRIIHVLRPGKGPKVFHDLMLPLMLSLPALL
NIALLIFLVMFIYAIFGMYNFAYVKKEAGINDVSNFETFGSSMLCLFQVTTFSGWDGMLD
AIFNSQWSDCDPDKINPGTQVRGDCGSPSVGIFYFVSYILISWLIIVNMYVVLIMEFLSI
PSKRKNRTLSEDDFRRFFKVWNRFDPDRTQYIDSTKLSDFAAALDPPLFMAKPNKGQLVA
MDLPMAAGDRIHCLDILLAFTKRVMGKDERVEKILSEIESGFMLANPFKITYEPITTTLK
RKQEAVSATIIQRAYKSYRLRQSDKKIQDIPEIDDGREDPNSKGVHSGQIEEKASIQTQI
NT seq 5043 nt   +upstreamnt  +downstreamnt
atgttgacttcgccagagccgaagggccttgtcccattcacggcagagtcacttgaactt
ataaaaaatcacattgctaaaaaatgcaacgaagagcatgaagaagaagatttaaaacca
agctggggtttagaagcaggcaaaaaacttccatttgcctatggaacccttcctcaagga
accgtgtcagagcccttggaagatgtggatccatactactatgttaagagaaatactttc
atggtcttaaacagaaacagagtcatcttcaggttcaatgcggtttccatcctctgcacg
ttgtctcctttaagctctctcagaagagctgttatcaaggttttggtgcacccccttttt
cgcctgctgattttaattagtgttctcaccgacagcatacttatgtgcatgagtaatcta
ccggaatggatattggcagtagagaatactttgcttgggatttacacattcgaaatactt
gtaaaagtcattgcaagaggtatctgggcagggtcattttccttccttggggatctttgg
aactggcttgatttcagtgtaactttgttcgagcttatcacaaggtcttcacctctaagc
tcccttccaatgtttaaaacaataagaaccttgcgaattttgaagatcattcctttgaac
catggcctgcagtctattgtggtgacgctggtccagtgtttgaagaaactactcggagcc
attgccctagctctgttttttctgactgtgtcttcgctattcgggatgggtctcttcatg
ggcaacctgaagcacaaatgtgtgcgatggccccaagaagatggaaatgatgtgatgtac
aatggaactggaagccagtaccatattctagaaagagaaaacttctactatatggaaggc
gcgagatacgctctcctctgcggcaacaagacagatgccggcctgtgtccagaaggttat
atgtgtgtaaaagagggctcaaatcctgacaatggcttcacaagttttgacaattttggc
tgggctctactggctatgtttcgattgatgactcaggattaccctgaattactttatcac
cagatcctttatgcttcaggaaagatctacatgatattttttgttctgatcagtttctgg
tttgccttctatatggcaagtttgttcttgggcatcctcactatggcctatgaacaggag
aagcagagagcttctgaggagtctagagacatggattctaaatgtcatcagactgtgaaa
gaattcgaggaagaacatgaaggagctgagatggaaactacacaaatagaaatgaagaaa
agatcaccaacctctataaacaccacattggatatactggaagacactgcccttggacac
aaagaagaaccagaaacatccaggaaggaatgcccactctgttggtataagtttactaaa
acctgctttatctggaaatgctctccctgttggataaaactgaatgagtttgctgacaga
attataacacacccattgtttgatcttttccttgttatatgcatcattttaaacatatgc
ttcctggccctagaacactttccaatgagtgaggagctcatgtcactccttgccattgga
aacttggtttttattggaatttacacaatagaaatgattttgaagataatcgctatgcat
ccatatgggtatttccaaataagctggcatatttttgacagtattcttgtggttttggga
ttaacagaaatgttactagcagatattgaagaaataactgtttttatattagtcccattg
atatttataaaattgggaaaatatgcaccaccatttaagaatttgatgcgtattcttggt
agagcattggtggccctgaaagacttggtcctgttggtctccattttcatttacttctct
gccgtgtttggcatgaagctgtttggtcgaagttacaaagattgtgtctgccacgtagat
caagactgtcaacgccaacgttggcacatgagtgacttcctccacgcctacgtgactgtg
ttccgaatcctctgcggagagtggatagagacattatgggagtgtatggaggttgcaggc
gaggcctggtgtattccattttacatgatggtcattttaattggaaatttattgatactt
tacctctttgtggcattggtgagctcatttgcttcatacgatgctaccacagaagtgagc
aaagaagccaaaaaccttcagcttgcagtggcatggataaaaatggtaataaactgtgtg
cttcttaaaatactgtgcaaagaaaaaactgtttctacagaagcaacagaccaaacatgt
gatccaagtgttaaagagaatatttctggtcatactctttctgaactgagcaacacccaa
acattcctcagatacaaggaccagagcagtggtactgagaaaactccagtgactgagtct
gagagccaatccctgattgctagtcccagtgtatcagaaactgtgccaattgcttcagga
gaatccgatatagaaaacctggataacaaggagactcggagcaagtctgcaaatggaagc
agtaaagagaaaatgaagcaatctagttcatctgagtgcagcacggttgatattgctatt
tctgaagaagaagaaatggtctatgaacatgaaaagtcgaagcttcataaaaatggttat
gaacgcaaatcttcagctggccaagtcagtagagaatctaggaatggaaagatttggagg
aacataaggaaaacttgctgcaagatagtggagaacagctggtttgagtgtttcattggc
ctggtcactctgctctgcacaggcactctggctctggaagacatatatattgatcagcgg
aaaaccattaaaatcttcctggagtatggagacatgatatttgcttacatcttcattctg
gagatgcttctcaagtgggtggcctacggctttaaagcctacttctctaacaactggtac
aagctggacttcatggtcgttatcgtgttgtgtcttagcttaataggcaaaactcgagag
gacctgaaccctctggcttccataaagttccttcgagcacttagagttctgtctcagttt
gaaagaatgaaggtggttctgagagctttgataaaaacaaccttacccgctgtgagcgtg
tttctggtctgcctaatgatctggctgcttttcagtgttatgggagtgttcttattcgct
ggcaagttctatgaatgcattgacccaacaaggggagaaagattctctgtatttgaagtt
atgaataagagtcagtgtgaaaacctggtatttaatgaatcaatgccatgggagaatgca
aaactgaactttgataatgttggaaatggttttctttctttgttccaagtggcaacattt
aatgggtggatcagtattatgaattcagcaattgactctgttggtgtgtacatgcagcct
agttttgagcacagcctccacatgtacacttactttatcatctttgttgtgtttggatta
tttcttcccttgtgtatgctgattggtgttattatcaggaatttcaacaagcagaaaatt
aagcagggaggatcaaatatctttataacggtaaagcagaagaaacagtaccgggcactg
aagaagctcttgtatgcagactctcagaaaccagcagcccgccctagaaacaagttccaa
ggcttcatttgtgacgtagtaacacatcgtgtctttaatgtcatcatcatacttcttatc
tgtttccaagcaacaaccattatgatacaaaatgatgagcagagtccacaaattgaaacc
gctgtcttctggatgaactccctttttaccatgctgttcactctggaatgcatactgaag
ctcaccgccttccgctgccactatttcaccagcgcatggaatgttcatgactttatggtg
gtcgttttctccattacaggactgctgctgcctttgtcaataggacaatactttgtgcct
ccttcactggtgcagctgcttcttctctctcgcatcatccatgtcctgcgtcctgggaaa
ggaccaaaggtgttccatgatctgatgcttcccttgatgctgtcactcccagcactgctc
aacattgctcttctcatcttcctggtcatgttcatctacgccatctttggaatgtacaac
ttcgcctacgtaaagaaagaagccggaattaatgatgtgtccaactttgagacctttgga
agcagtatgctttgtctctttcaagttacaacattttctggttgggacgggatgctggat
gcaattttcaacagtcagtggtctgactgcgatcctgataaaattaacccagggactcag
gtcaggggagactgtgggagcccttctgttgggattttttattttgtcagttacatcctc
atatcatggttgatcattgttaatatgtacgttgttttgatcatggagttcttaagtatt
ccttctaagagaaaaaacaggaccttgagcgaagatgactttaggagattcttcaaggta
tggaacaggtttgaccctgacaggacccagtacatagactctactaagctttctgatttt
gcagctgctctcgatcctcctcttttcatggcaaaaccaaacaagggccagcttgtagcc
atggatctccccatggctgcaggagacagaatccattgccttgatattttgcttgccttt
acgaaaagagtgatgggaaaggatgagcgggtggagaagatcctttcagagatagaatct
gggtttatgttagcgaaccctttcaaaattacgtatgagccgattacaacgactttgaaa
cgcaaacaagaggcagtctcagccactatcatccagcgggcatacaaaagttaccgctta
aggcaaagtgacaaaaagatacaagatatcccggaaatagatgatggcagggaggatcct
aactctaaaggtgtccactctggtcaaatcgaggaaaaggcatctattcagacccagatc
taa

DBGET integrated database retrieval system