KEGG   Rattus norvegicus (rat): 64156Help
Entry
64156             CDS       T01003                                 

Gene name
Uba52, Rps27a, Ubb
Definition
(RefSeq) ubiquitin A-52 residue ribosomal protein fusion product 1
  KO
K02927  large subunit ribosomal protein L40e
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03010  Ribosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    64156 (Uba52)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:rno03011]
    64156 (Uba52)
Ribosome [BR:rno03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    64156 (Uba52)
  Archaea
    64156 (Uba52)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 Rad60-SLD_2 TBK1_ULD Ubiquitin_5 DUF2407
Motif
Other DBs
NCBI-GeneID: 64156
NCBI-ProteinID: NP_113875
RGD: 68344
Ensembl: ENSRNOG00000019974
UniProt: P62986 Q6P7R7
Structure
PDB: 

Position
16p14
AA seq 128 aa AA seqDB search
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNN
LRPKKKVK
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcttcgtgaagaccctgacgggcaagaccatcactcttgaggtcgagcccagt
gacaccatcgagaatgtcaaggccaagatccaagacaaggaaggcatcccccctgaccag
cagagactgatctttgctggcaaacagctggaggatggccgcaccctgtccgactacaac
atccagaaagagtccaccttgcacctggtgctgcgtcttcgcggtggcatcatcgagccg
tcccttcgtcagcttgcccagaagtacaactgtgacaagatgatctgccgcaagtgctac
gcacgcctgcacccccgtgcagtcaactgccgcaagaagaagtgcggccacaccaacaac
ctgcgccccaagaagaaggtcaaatag

DBGET integrated database retrieval system