KEGG   Rattus norvegicus (rat): 64158Help
Entry
64158             CDS       T01003                                 

Gene name
Tuba1a, Tuba1
Definition
(RefSeq) tubulin, alpha 1A
  KO
K07374  tubulin alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04145  Phagosome
rno04210  Apoptosis
rno04530  Tight junction
rno04540  Gap junction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    64158 (Tuba1a)
  09143 Cell growth and death
   04210 Apoptosis
    64158 (Tuba1a)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    64158 (Tuba1a)
   04540 Gap junction
    64158 (Tuba1a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    64158 (Tuba1a)
   03036 Chromosome and associated proteins [BR:rno03036]
    64158 (Tuba1a)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    64158 (Tuba1a)
   04147 Exosome [BR:rno04147]
    64158 (Tuba1a)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     64158 (Tuba1a)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     64158 (Tuba1a)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    64158 (Tuba1a)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   64158 (Tuba1a)
  Exosomal proteins of other body fluids (saliva and urine)
   64158 (Tuba1a)
  Exosomal proteins of colorectal cancer cells
   64158 (Tuba1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Tubulin_3
Motif
Other DBs
NCBI-GeneID: 64158
NCBI-ProteinID: NP_071634
RGD: 619717
Ensembl: ENSRNOG00000060728
UniProt: P68370
Position
7q36
AA seq 451 aa AA seqDB search
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD
RIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYQPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGVDSVEGEGEEEGEEY
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagtgtatctccatccacgtcggccaggctggtgtccagatcggcaatgcctgc
tgggagctctactgcctggaacatggcatccagcctgatggccagatgccaagcgacaag
accattgggggaggagatgactccttcaacaccttcttcagtgagacaggagctggcaag
cacgtgccccgggcggtgttcgtagacctggaacccacagttattgatgaagttcgcact
ggcacctaccgccagctcttccacccagagcagctcatcacaggcaaggaagatgctgcc
aataactatgcccgtggccactacaccattggcaaggagatcattgaccttgtcttggac
agaattcgcaagctggctgaccagtgcacgggtctccagggcttcttggttttccacagc
tttggtgggggaactggctctgggttcacctccctgctgatggagaggctctctgtcgac
tacggaaagaagtccaagctggagttctccatttacccagccccccaggtttccactgct
gtggttgagccctacaattccatcctcaccacccacaccaccctggagcactctgattgt
gccttcatggtagacaatgaggccatctatgacatctgtcgtagaaacctcgacattgag
cgcccaacctacactaacttaaacaggttgataggtcaaattgtgtcttccatcactgct
tccctcagatttgatggggccctgaatgttgatctgacagaattccagaccaacctggtg
ccctaccctcgcatccacttccctctggccacttatgcccctgtcatctctgctgagaaa
gcctaccatgaacagctttctgtagcagagatcaccaatgcctgctttgagccagccaac
cagatggtgaaatgtgaccctcgccatggtaaatacatggcttgctgcctgctgtaccgt
ggtgatgtggtccccaaagatgtcaatgctgccattgccaccatcaagaccaagcgtacc
atccagtttgtggactggtgccccactggcttcaaggttggcattaattaccagcctccc
actgtggtccctggtggcgacctggccaaggtccagagagctgtgtgtatgctgagcaac
accacagccattgctgaggcctgggctcgcctggatcacaagtttgatctgatgtatgcc
aagcgtgcctttgtgcactggtacgtgggtgagggcatggaggagggagagttctctgag
gcccgtgaggacatggctgccctagagaaggattatgaggaggttggtgtggattctgtg
gagggtgagggtgaggaagaaggagaggaatactaa

DBGET integrated database retrieval system