KEGG   Rattus norvegicus (rat): 64159Help
Entry
64159             CDS       T01003                                 

Gene name
Sptan1, A2a, IPF, Spna2
Definition
(RefSeq) spectrin, alpha, non-erythrocytic 1
  KO
K06114  spectrin alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    64159 (Sptan1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:rno04812]
    64159 (Sptan1)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     64159 (Sptan1)
  Intermediate filaments
   Intermediate filament-binding proteins
    64159 (Sptan1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Spectrin EFhand_Ca_insen SH3_1 EF-hand_1 EF-hand_7 SH3_9 EF-hand_6 EF-hand_8 SH3_2 EF-hand_5 SH3_3 SCO1-SenC SH3_10 Tetrabrachion
Motif
Other DBs
NCBI-GeneID: 64159
NCBI-ProteinID: NP_741984
RGD: 621714
Ensembl: ENSRNOG00000015396
UniProt: P16086
Structure
PDB: 

Position
3p12
AA seq 2472 aa AA seqDB search
MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWI
QEKLQVASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETI
RTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQD
LEHVEVLQKKFEEFQTDLAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQEEVNAAWQRL
KGLALQRQGKLFGAAEVQRFNRDVDETIGWIKEKEQLMASDDFGRDLASVQALLRKHEGL
ERDLAALEDKVKALCAEADRLQQSHPLSANQIQVKREELITNWEQIRTLAAERHARLDDS
YRLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKSA
DESGQALLAAGHYASDEVREKLSILSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVD
NWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYA
MEDVATRRDALLSRRNALHERAMHRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEA
YKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKEEVAARMNEVISLW
KKLLEATELKGVKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKH
ALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKL
ADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRI
KAVTQKGNAMVEEGHFAAEDVKAKLSELNQKWEALKAKASQRRQDLEDSLQAQQYFADAN
EAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQV
APMDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAY
VKKLDPAQSASRENLLEEQGSIALRQGQIDNQTRITKEAGSVSLRMKQVEELYQSLLELG
EKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDL
KANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDEADSKTASPWKSARLMVH
TVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDN
YGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAQRLIQSHPESAEDLKEKCTELNQA
WTSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLER
HQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKEKLDILDQERTDLEKAWVQRRMM
LDHCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEK
IAALQAFADQLIALDHYAKGDIANRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDV
DEIEAWISEKLQTASDESYKDPTNIQSKHQKHQAFEAELHANADRIRGVIDMGNSLIERG
ACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLSEVEAL
LASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQVKEKRD
TINGRFQKIKSMATSRRAKLSESHRLHQFFRDMDDEESWIKEKKLLVSSEDYGRDLTGVQ
NLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGQEEIQQRLAQFVEHWKELKQLAA
ARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAFETDFT
VHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRKANVDENSAFLQ
FNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIANITALK
DQLLAAKHIQSKAIEARHASLMKRWTQLLANSATRKKKLLEAQSHFRKVEDLFLTFAKKA
SAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDRQIKSF
RVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDNVRQEFAQHANAFHQW
IQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEALILDN
KYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHFDKDKS
GRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFMISRET
ENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRELPTAF
DYVEFTRSLFVN
NT seq 7419 nt NT seq  +upstreamnt  +downstreamnt
atggatccaagtggggtcaaagtgctggaaacagccgaggacatccaggagagacgacag
caggttctggatcggtaccaccgcttcaaggagctctctaccttgcggcggcagaaactg
gaggattcctatcgcttccagttttttcagagagatgctgaggagctggagaagtggatt
caggagaagcttcaagttgcctctgatgagaactacaaagaccccaccaacttgcaggga
aagctccagaaacaccaagcctttgaagctgaagtacaggccaactcaggagccattgtg
aagctggatgagacaggaaacttgatgatttctgaagggcactttgcatctgagaccatc
cggacacgtttaatggagctgcaccgccagtgggagttgcttttggagaagatgcgggag
aaaggaatcaaactgctgcaggcacagaagctggtgcagtatttgcgggagtgtgaggat
gtaatggactggatcaatgacaaggaagcaattgtgacatctgaggagctgggccaggat
ttggagcatgtagaggtactacagaagaagtttgaagagtttcaaactgatctggctgct
catgaagaaagagttaatgaagtaaaccagtttgctgccaaacttatccaggagcagcac
ccggaagaggagctgatcaagaccaagcaggaggaggtgaatgcagcttggcagcgactg
aaaggcctggctcttcaaaggcaggggaagctctttggtgctgccgaggttcagcgcttt
aacagggatgtagatgagaccattggttggattaaggagaaagagcagttaatggcctct
gatgactttggcagagacttagcaagtgttcaagctctgcttcggaagcatgagggtctg
gagagagatcttgctgctctagaggacaaggtgaaagccctgtgtgccgaggctgaccgc
ctgcaacagtcacaccctctgagtgccaaccagatccaggtgaagcgagaggaactaatt
accaactgggagcagatccgaactctggccgcagagagacatgcacggcttgatgactca
tacaggcttcagcgctttcttgctgacttccgtgacctcacgagctgggtgactgaaatg
aaagccctcatcaatgcagatgaactggccaatgacgtggctggtgctgaggccctgctg
gacaggcatcaagagcacaagggtgaaatcgatgctcatgaagatagctttaagtctgca
gatgagtctgggcaggccctactcgctgctggtcactatgcctcagatgaagtgagggag
aagctgagcatcctctctgaggagagagctgccctgctggagctgtgggagcttcggagg
cagcagtatgagcagtgcatggacttgcagctcttctaccgagacactgagcaggtggac
aactggatgagcaaacaggaggcattcctgctaaatgaagatttgggtgactccttagac
agtgtggaagctcttttgaagaagcatgaggactttgagaaatctctcagtgcccaggaa
gaaaaaatcacagcacttgatgagtttgcaaccaagcttattcagaacaaccactacgca
atggaagatgtagccactcgacgagatgctctcctgagccgccgcaatgccctccatgag
cgagccatgcatcgccgggcacagctggccgattccttccacctgcagcagttcttccgc
gattccgatgagctcaaaagttgggtcaatgagaagatgaaaacggccactgatgaagct
tacaaagatccgtccaacctgcaagggaaagtccaaaagcaccaggcttttgaggctgag
ctctcagccaaccagagccgtattgatgccctagagaaagctgggcaaaaactaatagat
gtgaaccactatgccaaggaagaagtagcagctcggatgaatgaggtcatcagtttgtgg
aagaaacttctagaggccacagaactgaaaggagtcaagctccgagaagccaaccagcag
caacaatttaatcgcaatgttgaggacattgagttgtggctgtatgaagttgaaggtcac
ttggcttcagatgattatggtaaagacctcactaatgtccagaacctccagaagaagcat
gctctgctagaggcagatgttgctgctcaccaggatcgaattgacggcatcacaattcag
gcccgccagttccaagatgctggccatttcgatgccgaaaacattaaaaagaagcaagag
gcccttgtagctcgctatgaggctctcaaggaacccatggtggcccggaagcagaagctg
gcagattctcttcgtctgcagcagctcttccgagatgtggaggatgaggaaacctggatt
cgagaaaaggagcctattgctgcgtccactaacagaggcaaagatcttattggagtccag
aatctgctaaagaagcaccaagctttacaggcagaaattgctggccatgaacctcgcatc
aaagcagtgacacaaaagggcaatgccatggtggaggaaggccattttgctgctgaggat
gtgaaggccaaactgagtgagctcaaccagaagtgggaggcactgaaagccaaagcctcc
cagcggaggcaggatctggaggactcactacaggcccagcagtactttgccgacgccaat
gaagctgagtcctggatgcgggagaaggagcccattgtgggcagtaccgactatgggaag
gatgaagactctgctgaggctctgctcaagaagcatgaagctttgatgtccgatctcagt
gcctacggcagcagcattcaagctttgcgagagcaggctcagtcatgccggcaacaagtg
gcccccatggatgatgagactggcaaggagctggtcttggctctctatgactatcaagag
aagagccctcgtgaggtcaccatgaagaaaggggatatcctcaccttgctcaacagcaca
aacaaggactggtggaaagtggaagtgaatgaccgtcagggttttgtgccagctgcgtat
gtgaagaagctggaccccgcccagtcagcctcaagggagaacctcctggaagaacagggc
agcattgctctgcggcaggggcagatcgacaaccagacacgcataactaaggaggccggc
agtgtatctctgcgtatgaaacaggtggaagaactgtatcagtctctgctggagctgggt
gagaagagaaaaggcatgttggagaagagttgcaagaagttcatgttgttccgggaagcg
aacgagctacagcagtggatcaacgagaaggaagctgctctaacgagtgaagaggttggc
gctgacttggagcaggtcgaggtgctgcagaagaagttcgatgacttccagaaggatctg
aaagccaatgagtcccgcctgaaggacattaacaaagtggccgaggacctggagtctgaa
ggtctcatggcggaagaagtgcaggccgtgcagcagcaggaggtgtatggtatgatgccc
agggatgaagcagattccaagaccgcctccccatggaagtctgctcgactgatggtccac
acagtggccaccttcaactccatcaaggagctgaatgagcgctggcggtccctgcaacag
ctggctgaggaacgtagccagctcctgggcagtgcacacgaagtacagaggttccacagg
gatgcggatgaaaccaaagaatggattgaggagaagaaccaggctctgaacacagacaac
tatggccatgatctagctagcgtccaggccctgcagcgcaaacacgaaggcttcgagagg
gaccttgcagctcttggtgacaaggtgaattcccttggggaaacagcccagaggctgatc
cagtcccaccctgaatctgcagaggacttaaaggaaaagtgcacagagttaaaccaggcc
tggaccagcctagggaagcgtgcagaccagcgcaaggccaaactgggtgactcccatgac
ctgcagcgcttccttagcgatttccgggacctcatgtcttggatcaatggaatacgaggg
ttggtatcttcagatgaactggccaaggatgtcactggagctgaggctttgctggagcga
caccaggaacaccggacagaaattgatgccagggctggcactttccaggcatttgagcag
tttgggcagcagctgttggctcatgggcactatgccagcccagagatcaaggagaaactt
gatattcttgaccaggagcgcacagacctggagaaggcctgggttcagcgcagaatgatg
ctggaccactgcctggagttgcagctgttccatcgagactgtgagcaagcagagaactgg
atggctgcccgggaagccttcctaaacacagaagacaaaggagactcgctggacagtgtg
gaggctctgatcaaaaaacatgaagacttcgacaaagctatcaatgtccaggaggagaag
atagctgccctgcaggcctttgccgaccagctcattgctctggaccactatgccaaggga
gacattgcaaaccgacgcaatgaggtcctggacaggtggcgccgcctaaaagcccagatg
attgagaaaaggtcaaagctcggagaatctcaaacacttcagcagttcagccgggatgta
gatgagattgaagcttggatcagtgagaagttacaaacagccagcgatgagtcatacaag
gaccccaccaacatccagagcaagcaccagaagcaccaagcctttgaggcagaactgcac
gccaatgctgaccgaatccgtggagttattgacatgggcaactccctcattgagcgtggg
gcctgtgctggcagtgaggatgctgtcaaggcccgcctggctgcccttgcagaccagtgg
cagttcctggtgcagaagtcagctgagaagagccagaagctgaaagaggccaataagcag
cagaacttcaacaccgggatcaaagactttgacttctggctttctgaggtggaggctctc
ctggcatctgaagactacggcaaagacctggcttccgtgaacaacctgctcaaaaagcat
cagctgctggaggcagacatatcggcccacgaggatcgtctgaaggacctgaacagccag
gctgacagcctgatgactagcagtgccttcgacacctcccaagtgaaagagaagcgggac
accatcaatggacgctttcagaagatcaagagcatggcaacctcccgaagagcaaaactg
agcgagtcccatcgcctgcaccagtttttccgagacatggatgacgaggagtcctggatc
aaggagaagaagttgttagtgagctctgaggactatggcagagacctcactggtgttcaa
aatctgaggaagaaacacaagcggctagaagccgaactggccgcacacgaaccagccatt
cagggtgtcctggacacggggaagaagctgtctgatgacaacaccatcgggcaggaggag
atccagcagcgtctcgcacagtttgtggagcactggaaggaactgaaacagctagcagct
gcacggggccagcggctggaggagtccttggagtatcagcagtttgtggccaacgtggag
gaggaggaggcttggatcaatgagaagatgaccctggtggccagcgaagactacggggac
actcttgctgccatccagggcttactgaagaaacatgaagcatttgagacagacttcact
gtccacaaggatcgagtgaatgatgtctgtactaatggacaagacctcattaagaagaac
aatcaccatgaggagaacatctcttcaaagatgaagggtctgaatggtaaagtgtctgac
ctggagaaagcagcagctcagcggaaagcgaacgtggatgagaactcggccttccttcag
ttcaattggaaggctgacgtggtggagtcctggattggtgaaaaggagaacagcttgaaa
acagatgattatggccgagatctgtcttctgtccaaactctgctcaccaagcaggagaca
tttgatgctggcctgcaggccttccagcaggagggcattgccaatatcactgccctcaaa
gaccagctgctagctgccaagcacattcagtcgaaggccatcgaggcccgacatgcctcc
ctcatgaagaggtggacccagctgttggccaattcagctacccgcaagaagaagttgcta
gaggcccagagtcatttccgaaaggtagaagacctcttcctgacctttgccaaaaaggca
tcggctttcaacagctggtttgagaatgcagaagaggacctcacagacccagtgcgctgc
aactctctggaagaaatcaaagccctccgagaggctcatgatgccttccgctcatcgctc
agctctgcgcaggccgacttcaaccagctagccgagctggaccgtcagatcaagagtttc
cgagtggcctccaatccctacacctggttcaccatggaggccctggaagagacgtggagg
aacctacagaagatcattaaggagcgagaactggagctgcagaaggaacagcggcggcag
gaggagaatgacaacgtacgccaagagtttgcccagcatgccaacgcgttccaccagtgg
atccaggaaacaagaacgtatctcctcgacgggtcctgcatggtcgaagagtcgggaact
ctggaatctcagcttgaagctaccaaacgcaagcaccaggagattcgggccatgagaagt
cagctgaagaagattgaggacctgggtgctgccatggaggaagccctcatcctggacaac
aagtacactgagcacagcactgtgggcctggcccagcagtgggaccagttagaccagctg
ggcatgcgcatgcagcacaacctggagcagcagatccaggccaggaacacaacaggagtc
actgaggaggccctcaaggagttcagcatgatgttcaaacacttcgacaaggacaagtct
ggccggctgaatcatcaagagttcaaatcctgccttcgttctctgggttacgacctgcca
atggttgaggaaggagagcctgatcctgagtttgaggccatactggacactgttgatccc
aacagggacggccacgtctccctgcaagagtacatggctttcatgatcagccgtgaaacc
gagaatgtcaagtccagtgaagagatcgagagtgctttccgggccctcagctccgagggc
aagccttatgtgaccaaggaggagctctaccagaacctgacccgggaacaagctgactac
tgtgtctcccacatgaagccctatgtggatggcaagggccgcgaacttccaactgccttc
gactacgtggagttcacccgttctctctttgtgaattga

DBGET integrated database retrieval system