KEGG   Rattus norvegicus (rat): 64161
Entry
64161             CDS       T01003                                 

Gene name
Pi4ka
Definition
(RefSeq) phosphatidylinositol 4-kinase alpha
  KO
K00888  phosphatidylinositol 4-kinase A [EC:2.7.1.67]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00562  Inositol phosphate metabolism
rno01100  Metabolic pathways
rno04070  Phosphatidylinositol signaling system
Module
rno_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    64161 (Pi4ka)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    64161 (Pi4ka)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    64161 (Pi4ka)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.67  1-phosphatidylinositol 4-kinase
     64161 (Pi4ka)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Others
   EFR3-PI4KIII alpha complex and associated proteins
    64161 (Pi4ka)
 Endosome - Golgi transport
   Others
    64161 (Pi4ka)
SSDB
Motif
Pfam: PI4K_N PI3_PI4_kinase PI3Ka ABC1
Other DBs
NCBI-GeneID: 64161
NCBI-ProteinID: NP_071637
RGD: 621213
Ensembl: ENSRNOG00000060045
UniProt: O08662
Position
11
AA seq 2105 aa
MAAAGARGGGGGGAGAGTGGSGSSSGSSTSRGFYFNTVLSLARSLAVQRPASLEKVQKLL
CMCPVDFHGIFQLDERRRDAVIALGIFLIESDLQHKDCIVPYLLRLLRGLPKVYWVEEST
ARKGRGNLPVAESFSFCLVTLLSDVACRDPSLRDEILEALLQVLHVLLGMCQALEIQEKE
YLCKYAIPCLIGISRSFGRYSNSEESLLSKLFPKVPPHSLRIPEELEGVRRRSFNDFRSI
LPSNLLTVCQEGTLKRKTSSVSSISQVSPERGMPPPSSPGGSAFHYFEASCLPDGTTLEP
EYYFSTISSSFSVSPLFNGITYKEFYIPLEMLRELLNLVKKIVEEPVLKSLDAAVARVME
ANPSADLYYTTFSDPVYLTMFKMLRDTLYYMKDLPTSFVKEIHDFVLEQFNMSQGELQKI
LHDADRIHSEMSPLKLRCQANAACVDLMVWAVKDEQGAENLCIKLSEKLQSKTSSKVIIA
HLPLLICCLQGLGRLCERFPVVVHSVTPSLRDFLVIPSPVLVKLYKYHSQYHTVAGSDIK
ISVTNEHSESTLNVLPGKKNQPSMYEQLRDIAIDNICRCLKAGLTVDPVIVEAFLASLSN
RLYISQESDKDAHLIPDHTIRALGHIAVALRDTPKVMEPILQILQQKFCQPPSPLDVLII
DQLGCLVITGNQYIYQEVWNLFQQISVKASSVVYSATKDYKDHGYRHCSLAVINALANIA
ANIQEEHLVDELLMNLLELFVQLGLEGKRASERASEKGPALKASSSAGNLGVLIPVIAVL
TRRLPPIKEAKPRLQKLFRDFWLYSVLMGFAVEGSGLWPEEWYEGVCEIATKSPLLTFPS
KEPLRSVLQYNSAMKNDTVTPAELNELRSTIINLLDPPPEVSALINKLDFAMSTYLLSVY
RLEYMRVLRSTDPDRFQVMFCYFEDKAIQKDKSGMMQCVIAVADKVFDAFLNMMAEKAKT
KENEEELERHAQFLLVNFNHIHKRIRRVADKYLSGLVDKFPHLLWSGTVLKTMLDILQTL
SLSLSADIHKDQPYYDIPDAPYRITVPDTYEARESIVKDFAARCGMILQEAMKWAPTVTK
SHLQEYLNKHQNWVSGLSQHTGLAMATESILHFAGYNKQNTTLGVTQLTERPACVKKDYS
NFMASLNLRNRYAGEVHGMIRFSGATGQMSDLNKMMVQDLITALDHSHPQHYTQAMFKLT
AMLISSKDCDPQLLHHLCWGPLRMFNEHGMETALACWEWLLAGKNGVEVPFMREMAGAWH
MTVEQKFGLFSAETKEADPLAASEASQPRPCPPEVTPHYIWIDFLVQRFEIAKYCSSDQV
EIFSSLLQRSMSLHIGGARGSMNRHVAAIGPRFKLLTLGLSLLHADVVPNATIRNVLREK
IYSTAFDYFSCPPKFPTQGEKRLREDISIMIKFWTAMFSDKKYLTASQLVPPDNQDTRSN
LDITVGSRQQATQGWINTYPLSSGMSTISKKSGMSKKTNRGSQLHKYYMKRRTLLLSLLA
TEIERLITWYNPLSAPELELDQAGENSVANWRSKYISLSEKQWKDNVNLAWTISPYLAVQ
LPARFKNTEAIGNEVTRLVRLDPGAVSDVPEAIKFLVTWHTIDADAPELSHVLCWAPTDP
PTGLSYFSSMYPPHPLTAQYGVKVLRSFPPDAILFYIPQIVQALRYDKMGYVREYILWAA
AKSQLLAHQFIWNMKTNIYLDEEGHQKDPDIGDLLEQLVEEITGSLSGPAKDFYQREFDF
FNKITNVSAIIKPYPKGDERKKACLSALSEVKVQPGCYLPSNPEAIVLDIDYKSGTPMQS
AAKAPYLAKFKVKRCGVSELEKEGLQCRSDTEDECRRQEADGKKICWQAAIFKVGDDCRQ
DMLALQIIDLFKNIFQLVGLDLFVFPYRVVATAPGCGVIECIPDCTSRDQLGRQTDFGMY
DYFTRQYGDESTLAFQQARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLDKKGHIIHIDFG
FMFESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFMEMCVRGYLAVRPYMDAVVSL
VTLMLDTGLPCFRGQTIKLLKHRFSPNMTEREAANFIMKIIQNCFLSNRSRTYDMIQYYQ
NDIPY
NT seq 6318 nt   +upstreamnt  +downstreamnt
atggcggctgctggggcccggggaggcggcggcggcggcgccggcgccggcaccggcggc
tcggggtccagctctggttccagcacctcccgaggtttttatttcaacacagtgctttca
ctggcccgctccctggctgtgcagagacctgcatccttagagaaggttcaaaagctgctg
tgcatgtgcccagtagattttcatggaatcttccagctagatgaaagacggagagatgca
gtgattgctctgggcatttttctcattgagtctgatcttcagcacaaagattgtattgtt
ccttatcttcttcgacttctcaggggtcttccaaaagtctattgggtagaagaaagcaca
gctcggaaaggcagaggtaacctcccggttgcagaaagcttcagcttctgcctggtgacc
ttgctgtctgatgtggcttgcagggacccctcacttagggatgagattttagaggcactt
ttgcaggttttacatgtccttctgggaatgtgccaggccctggagattcaagagaaagaa
tacctttgcaagtatgcaatcccatgcctgatagggatctcgagatcttttggacgttac
agcaattcagaagaatctctcctctcaaagctttttcccaaagtccctcctcattccctg
agaatccccgaagagctagaaggtgtccgaaggcgttcctttaatgacttccgctccatc
ctgcccagcaacctgctgactgtctgtcaggagggcacactgaagaggaaaaccagcagt
gtgtccagcatctctcaggttagcccagaacgtggcatgccccctcccagctcccctgga
ggatctgcttttcactattttgaagcctcttgcctgcctgatggaaccaccttggagccc
gaatactacttctctaccatcagctccagtttttctgtctctcccctgttcaatggtatc
acctataaggagttctatattccactggaaatgcttcgagaactcttaaacttggtaaag
aagattgttgaggagcctgttctcaagtccttagatgcagctgtagccagagtgatggag
gccaatcccagtgctgacctatactacacgaccttcagtgatcccgtctacctgaccatg
ttcaagatgcttcgagacactctgtactatatgaaagacttacccacctcctttgtgaaa
gagatccatgattttgtgttggagcagttcaacatgagccaaggggaactccaaaagatt
ctccatgatgcagacaggatccacagtgagatgagcccactcaaactgcgctgccaagca
aatgctgcctgcgtagacctcatggtgtgggctgtgaaggatgagcagggtgcagaaaac
ctttgcatcaagctgtctgaaaagctgcagtccaagacatccagcaaggtcatcatcgcc
catttgcccttgctgatctgctgcctacagggtctgggccgcctatgtgaacggttcccg
gtggtggtccactcagtgacaccatctttgagagactttctggtgattccatccccagtg
ctggtgaagctctataagtaccacagtcagtaccacacagttgctggcagtgatataaaa
attagtgtcaccaatgagcattctgagtcaactctgaatgtcttgcccggcaagaagaac
cagccatccatgtatgagcagctccgggacatcgccattgacaacatctgcaggtgcctg
aaggccggcctcaccgtggaccctgtgatcgtggaggccttcctggccagcctctccaac
cggctctatatctcccaggagagcgataaggatgctcacttgattcctgaccataccatt
cgtgccttgggacacattgcagtggctctgagggataccccaaaggtcatggagccaatt
ctgcagatcctgcagcagaaattttgccagcccccctcacccctcgatgtgctcatcatc
gaccagctgggctgcctggttatcactggaaatcaatacatttatcaggaagtgtggaat
ctcttccaacaaatcagtgtgaaggccagttcagttgtatattcagccaccaaagactac
aaagaccatggctacaggcactgctccctcgcagtcatcaatgccctggccaacatcgca
gccaacattcaggaggagcaccttgtggatgagctgttgatgaacctgctggaactgttt
gtgcagctggggctggaggggaagagagccagtgagagggccagcgagaaggggcccgcc
ctgaaggcttccagcagtgcagggaatttgggagtgctcattcctgtaatagccgtgctc
acccgacgattgccacccatcaaagaagctaaacctaggctacaaaagcttttccgagac
ttctggctctactctgtgctaatgggattcgctgtggaaggctcagggctctggccggaa
gagtggtatgaaggagtctgtgaaatagcaaccaagtcacctctgcttacctttcccagc
aaagagcctcttcgatcagtcctccagtacaactcagccatgaaaaatgatacagtgacc
ccggctgagctgaatgagctccgaagtaccatcatcaacttgctagatcctcctcctgag
gtgtctgccctcatcaacaagctggactttgccatgtccacctatctcttgtctgtgtat
cggctggaatacatgagggtgctgcgttctacagatccagatcgcttccaggtaatgttc
tgctacttcgaggataaagctattcagaaagacaaatctgggatgatgcagtgtgtcatc
gctgttgctgacaaagtatttgatgccttcctgaacatgatggcagaaaaagccaagacc
aaggagaatgaagaggagttggagcggcatgcccagtttctgctggtgaacttcaaccac
attcacaagaggatacgcagagtggctgacaagtacctgtctggtctggtggataagttt
ccacacttgctctggagtgggactgtgctgaagaccatgttggacattctgcagaccctg
tcactatcactaagtgctgatattcacaaggaccaaccttattatgacattcctgacgcc
ccctatcggatcacggttcctgacacgtatgaagcccgggagagcatcgtgaaagacttt
gctgcacgctgtgggatgatcctgcaggaagccatgaagtgggcacccacggtcactaag
tcccacctgcaggaatatctgaacaagcatcagaactgggtgtcaggactgtcccagcac
acgggattggccatggccactgagagcatccttcactttgccggctacaacaagcagaac
acaactcttggggtaactcagctcactgagcgcccggcctgtgtgaagaaagactactcc
aacttcatggcatccttgaatttgcgcaaccgctatgccggcgaggtgcacgggatgatt
cggttctcaggtgccacaggccagatgtccgacctgaacaaaatgatggtccaggatctg
attacagctctggaccacagtcatcctcagcactatacccaagccatgttcaaattgacg
gccatgctcattagcagcaaagattgtgacccacagctccttcatcatctgtgttggggt
cccctccggatgttcaacgagcatggcatggagactgcactagcctgctgggagtggctg
ctggctggcaagaatggagtggaagtgccgttcatgcgggagatggcaggagcctggcac
atgacagtggagcagaagttcggcctcttctctgcagaaacaaaggaagcagatcccctg
gcagcgtcagaagcaagtcagccacgaccctgtccccctgaagtgacacctcactacatc
tggattgatttcctggtgcagcggtttgagattgccaagtactgtagctctgaccaggtg
gagatcttctcaagcctgctgcagcgctccatgtccctccacatcggtggagccaggggg
agcatgaacaggcatgtggcagccattggaccacgtttcaaactgctgaccctggggctg
tccctcctacacgctgatgtggttccaaatgcaaccattcgaaacgtgcttcgagagaag
atctactcaacagcctttgactatttcagttgtccaccaaagttccctactcaaggagaa
aagaggctgcgtgaagatataagcatcatgattaagttttggactgccatgttctcagat
aagaagtacctgactgccagccaactcgttcccccagataaccaggacacccgaagcaac
ttggatataactgtgggctctcgacaacaggctacacagggatggatcaacacatacccc
ctctccagtggcatgtcaactatctccaaaaaatcaggcatgtctaagaaaaccaaccga
ggttcccagctgcacaagtactacatgaagcgtaggacgctgctgctgtcactgttggcc
actgagatcgagcgcctcatcacttggtacaacccgctgtcagccccagagctagagctg
gaccaggcaggtgagaacagtgttgccaactggaggtccaagtatatcagcctgagtgag
aagcagtggaaggacaacgtgaaccttgcctggaccatctctccatacctcgctgtgcag
ctgccagccaggttcaagaatacagaagccattggaaatgaagtgacccgtctcgttcgc
ctggacccaggagctgttagtgatgtccctgaagctatcaagttccttgtcacctggcac
accatcgatgctgatgctccagagcttagccatgtgttatgctgggcacccacggacccg
cccacgggcctctcctacttctccagcatgtaccccccacaccctctcactgcacagtat
ggggtgaaagtcctgcggtccttccctccggatgccattctgttctacatcccccagatt
gtgcaggccctcagatatgacaagatgggctatgtgcgcgagtacattctctgggctgca
gccaaatcccagcttctggcacaccagtttatttggaatatgaaaactaacatctacctt
gatgaagaagggcaccagaaagaccctgacattggtgaccttctggagcagttagtagaa
gaaatcacagggtctctatcaggcccagccaaagatttctatcaacgggaatttgatttc
tttaacaagatcaccaacgtgtcagccatcatcaagccctaccctaaaggcgatgaaaga
aagaaggcttgtctgtcagccctgtctgaagtgaaggtgcagcctggctgctacctgccc
agcaaccctgaagcaattgtgctagacattgactacaagtcagggacaccaatgcagagt
gctgcaaaagcgccgtatcttgccaagtttaaggtgaagcgatgcggagtgagtgaactt
gaaaaagaaggtctgcagtgccgctcagacacagaggatgagtgccgcaggcaagaggct
gatggcaagaagatctgctggcaagcagccatcttcaaagtgggggatgactgccgacag
gacatgctagccctgcagatcatcgaccttttcaagaacatcttccagctggttggcctg
gacctcttcgtttttccctatcgggtagtggctactgcccctgggtgtggggtgattgag
tgcattccagactgtacctcccgagaccagctaggccgccagactgacttcggcatgtat
gactactttacacgccagtatggggacgagtctaccttggccttccagcaggcacgctac
aactttatcagaagcatggcggcctacagcctcctgctgttcctgctgcagatcaaggac
aggcacaacggcaacatcatgctggacaagaagggacacatcatccacatagactttggc
ttcatgtttgaaagctcaccgggtggcaaccttggctgggagccagacatcaagctgaca
gacgagatggtgatgattatggggggcaagatggaagccacacccttcaagtggttcatg
gagatgtgcgtccgaggttatctggctgtgcgcccctatatggatgcagtcgtctccctg
gttacactcatgttggacacaggcctgccctgtttccgtggccagacaatcaaacttttg
aaacacaggttcagcccgaacatgacagagcgggaggctgcaaattttatcatgaagatc
atccaaaactgtttcctcagcaacaggagccggacctacgacatgatccagtactaccag
aatgatatcccctactga

DBGET integrated database retrieval system