KEGG   Rattus norvegicus (rat): 641645
Entry
641645            CDS       T01003                                 

Gene name
Defb15
Definition
(RefSeq) defensin beta 15
Organism
rno  Rattus norvegicus (rat)
SSDB
Motif
Pfam: Defensin_beta_2
Other DBs
NCBI-GeneID: 641645
NCBI-ProteinID: NP_001032609
RGD: 1563061
Ensembl: ENSRNOG00000048359
UniProt: Q32ZH6 A0A0G2JSX4
Position
16q12.5
AA seq 91 aa
MDTVLTLTALQVMKTFLFLFAVFFFLDPAKNAFFDEKCSRINGRCTESCLKNEELIALCQ
KNLKCCVTVQPCGRDKGDELDEDSGYNRTRG
NT seq 276 nt   +upstreamnt  +downstreamnt
atggacaccgtgctgaccctcacagcccttcaggtcatgaagacgttcttatttctcttt
gctgttttcttctttcttgacccagccaagaatgcatttttcgatgagaagtgcagcagg
attaatgggagatgcacagaatcttgtctgaagaatgaagaactcattgctctctgccag
aagaacctgaagtgctgtgtgacagtccagccgtgtgggagggacaagggcgacgagttg
gatgaagactcgggctacaacaggactcggggatga

DBGET integrated database retrieval system