KEGG   Rattus norvegicus (rat): 641659
Entry
641659            CDS       T01003                                 

Gene name
Tpcr12
Definition
(RefSeq) putative olfactory receptor
  KO
K04257  olfactory receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    641659 (Tpcr12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    641659 (Tpcr12)
G protein-coupled receptors [BR:rno04030]
 Others
  Chemoreception
   Olfactory
    641659 (Tpcr12)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx DUF3810
Other DBs
NCBI-GeneID: 641659
NCBI-ProteinID: XP_001070532
RGD: 1589570
Ensembl: ENSRNOG00000048210
UniProt: M0RAN7
Position
10q21
AA seq 317 aa
MTWTGNQTLISHFVLLGLFTHSPLHLFLFSIIMLMFLVALSGNGLMILLILVDSRLHSPM
YFFLSWLSLMDLMLISTIVPRMAADFLMGRGSISFAGCGLQILFFLTLLGDECFLLAFMA
YDRYVAISNPLRYSVIMSRRVCWLMVAGSWLFGLVDGLIQAVFTLRFPYCSSQEIDHFFC
EVPAVLKLACADTSLYETMIYVCCVLMLLLPFSVISASYIRILVAVLRMRSAEGRQKAFA
TCSSHMIVVSLFYGAAMITYMRPQAYHSSKQDKVVSAFYTMITPMLNPLIYSLRNKEVTG
ALRKLLGKCPCGGGTLV
NT seq 954 nt   +upstreamnt  +downstreamnt
atgacctggacaggcaaccagactctcatctctcactttgtcctcctgggcctcttcacc
cactctccactgcatctcttcctcttctccatcattatgctcatgttcctggtggccctc
tctggcaacgggctcatgatcctcctcatccttgtggactctcgcctgcacagccccatg
tacttcttcctcagttggctatccctcatggacctcatgctcatctccaccattgtgcca
cggatggctgctgactttctcatgggccgtggctctatctccttcgctggctgtggcctc
cagattctcttcttcctcaccctcctgggggatgagtgcttcctgctggccttcatggcc
tatgaccgttatgtggccattagcaacccgctgaggtactctgtaatcatgagccgccgc
gtctgctggctcatggtagcggggtcttggctctttggcctggtagatggactgatccag
gctgtttttacgcttcgcttcccctactgcagttcccaggagatcgaccacttcttctgt
gaggttcctgctgtgctcaagctggcctgtgctgacacctctctctatgagaccatgatc
tatgtctgctgtgtcctcatgcttctcctgcccttttctgtcatctcggcctcctacatc
cggatcctggtggcagtgctccggatgcgctctgcagaaggtcggcagaaggccttcgct
acctgttcctcccacatgattgtggtctccctcttctacggggccgccatgatcacatac
atgcgaccacaggcctaccattcctccaagcaggacaaagtggtctctgccttctacacc
atgatcacccccatgctcaaccctcttatttacagtctaaggaacaaagaagtgactggg
gccctgaggaaactcctgggaaagtgtccctgtggaggtgggactcttgtttga

DBGET integrated database retrieval system