KEGG   Rattus norvegicus (rat): 64190
Entry
64190             CDS       T01003                                 

Symbol
Fxyd4
Name
(RefSeq) FXYD domain-containing ion transport regulator 4 precursor
  KO
K13359  FXYD domain containing ion transport regulator 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    64190 (Fxyd4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    64190 (Fxyd4)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   64190 (Fxyd4)
SSDB
Motif
Pfam: ATP1G1_PLM_MAT8 DUF3311
Other DBs
NCBI-GeneID: 64190
NCBI-ProteinID: NP_001355592
RGD: 70998
Ensembl: ENSRNOG00000014578
Structure
PDB: 
2JP3

Position
4
AA seq 87 aa
MEGITCAFLLVLAGLPVLEANGPVDKGSPFYYDWESLQLGGMIFGGLLCIAGIAMALSGK
CKCRRNHTPSSLPEKVTPLITPGSAST
NT seq 264 nt   +upstreamnt  +downstreamnt
atggagggaataacctgtgcctttctcctggtgctagcaggtctgcctgtcttggaagcc
aatggtccagttgataaaggcagtcccttctactacgactgggagagcctgcaactggga
ggaatgatctttggggggctcctgtgcatcgctggaattgccatggccctgagtggcaag
tgcaaatgtaggcgcaaccatacgcccagttccttacctgagaaagtcactccactcatc
actccaggctctgccagtacctga

DBGET integrated database retrieval system