KEGG   Rattus norvegicus (rat): 64192
Entry
64192             CDS       T01003                                 

Gene name
Qdpr
Definition
(RefSeq) quinoid dihydropteridine reductase
  KO
K00357  dihydropteridine reductase [EC:1.5.1.34]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00790  Folate biosynthesis
rno01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    64192 (Qdpr)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     64192 (Qdpr)
SSDB
Motif
Pfam: adh_short adh_short_C2 Epimerase Peptidase_S66 PRMT5
Other DBs
NCBI-GeneID: 64192
NCBI-ProteinID: NP_071785
RGD: 619915
Ensembl: ENSRNOG00000003253
UniProt: P11348
Structure
PDB: 
1DHR 1DIR

Position
14q11
AA seq 241 aa
MAASGEARRVLVYGGRGALGSRCVQAFRARNWWVASIDVVENEEASASVIVKMTDSFTEQ
ADQVTAEVGKLLGDQKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLAT
KHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPSGAAAIAVLPV
TLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGNKRPNSGSLIQVVTTDGKTELTPAY
F
NT seq 726 nt   +upstreamnt  +downstreamnt
atggcggcttcgggcgaggcgcgccgagtgctggtgtacggcggcaggggtgctctgggc
tcgcgctgcgtacaggccttccgggcccgcaactggtgggttgccagcattgatgtggtg
gagaatgaagaggccagtgccagcgtgattgttaagatgacagattcattcacggagcag
gctgaccaggtcactgctgaggtcgggaagctcctaggtgaccagaaggtggatgccatt
ctctgtgtggctggaggatgggccgggggcaatgccaaatccaagtcactctttaaaaac
tgtgacctgatgtggaagcagagtatttggacatccaccatctctagccacttggccaca
aagcacctgaaggaaggaggcctcttgaccctggccggggccaaagctgcgttggatggg
actcctgggatgattggctacggcatggccaagggagccgtccatcagctctgccagagc
cttgcagggaagaacagtggcatgccgtctggggctgccgccattgctgtgcttcccgtc
accctggatactccgatgaacaggaaatcaatgcccgaggcagacttcagctcctggaca
cccttagagttcctggtggagaccttccatgactggatcactgggaacaaacggccaaac
tcaggaagcctaatccaggtggtaaccacagacgggaagacagagcttactccagcctat
ttctaa

DBGET integrated database retrieval system