KEGG   Rattus norvegicus (rat): 64198
Entry
64198             CDS       T01003                                 

Gene name
Pmpcb, Mppb
Definition
(RefSeq) peptidase, mitochondrial processing beta subunit
  KO
K17732  mitochondrial-processing peptidase subunit beta [EC:3.4.24.64]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    64198 (Pmpcb)
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:rno03029]
    64198 (Pmpcb)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.64  mitochondrial processing peptidase
     64198 (Pmpcb)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M16: pitrilysin family
   64198 (Pmpcb)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    64198 (Pmpcb)
SSDB
Motif
Pfam: Peptidase_M16 Peptidase_M16_C
Other DBs
NCBI-GeneID: 64198
NCBI-ProteinID: NP_071790
RGD: 621297
Ensembl: ENSRNOG00000012693
UniProt: Q03346
Position
4q11
AA seq 489 aa
MAAAAVSRTLLPVAGRRLWGFTRRLPLRAAAAQPLYFGGDRLRSTQAAPQVVLNVPETQV
TCLENGLRVASENSGISTCTVGLWIDAGSRYENEKNNGTAHFLEHMAFKGTKKRSQLDLE
LEIENMGAHLNAYTSREQTVYYAKAFSKDLPRAVEILADIIQNSTLGEAEIERERGVILR
EMQEVETNLQEVVFDYLHATAYQNTALGRTILGPTENIKSISRKDLVDYITTHYKGPRIV
LAAAGGVCHNELLELAKFHFGDSLCAHKGDVPALPPCKFTGSEIRVRDDKMPLAHLAVAI
EAVGWTHPDTIRLMVANTLIGNWDRSFGGGMNLSSKLAQLTCHGNLCHSFQSFNTSYTDT
GLWGLYMVCEQATVADMLHAVQKEWMRLCTAVSESEVARAKNLLKTNMLLQLDGSTPICE
DIGRQMLCYNRRIPIPELEARIDAVDAEMVREVCTKYIYGKSPAIAALGPIERLPDFNQI
CSNMRWTRD
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggcggcggcggctgtatcccggacgttgttgccggtggccggacggcgcctgtgggga
tttacgcgaaggcttccgctccgcgccgccgctgctcagccattgtactttggaggggac
cgactcagaagtacacaggctgctccacaagttgttctgaatgttcctgagacacaagtc
acttgtttggaaaatggactcagggtagcttctgaaaactctgggatctcaacatgcacc
gttgggctgtggatcgatgctggcagtcggtatgagaatgaaaagaacaatggcaccgct
cactttctggagcacatggctttcaagggcactaaaaagaggtcccagttagaccttgaa
cttgagattgagaacatgggtgcccatctcaatgcctatacctccagagagcagactgtc
tactacgccaaagccttctccaaagatttgccaagagctgtagaaattcttgctgacata
attcagaacagtacattgggagaggcagagattgaacgtgagcgtggagtcatcctcaga
gaaatgcaggaagttgagaccaacttgcaagaagttgtctttgattatctgcacgccaca
gcctatcaaaacaccgcgctcggacggacaattctgggaccaaccgagaacatcaaatct
ataagccgtaaggacttagtggactacataaccacacattataagggaccaagaatcgtg
ctggctgctgctggaggtgtttgccataacgaactgctggagttagcgaagtttcatttt
ggtgactctttgtgcgcacacaaaggagatgtaccagctctgcctccctgtaaattcact
ggaagcgagattcgggtgagggatgacaagatgccactggcgcacctcgcagtggctatt
gaagcagttggttggacgcacccagacacgatccgtctcatggtcgcaaacacactgata
ggcaactgggaccgctctttcggaggaggaatgaatttatcgagcaagctggcccagctc
acgtgccatggcaatctctgccacagcttccagtccttcaacacctcctacacagacaca
ggattgtgggggctctatatggtttgtgaacaagccacagttgctgacatgctgcacgct
gtacaaaaggaatggatgcgtctgtgcacagctgttagtgagagtgaggtcgcacgcgcc
aaaaaccttctcaagacaaacatgctgctgcagcttgatgggtcaactccgatctgtgaa
gacatcggtaggcagatgctatgctacaacaggagaatccccatccctgagcttgaggcc
aggatcgatgctgtggacgcggagatggttcgagaagtgtgcaccaagtacatttatggc
aaaagcccggccattgctgctctcggtcctattgagcgcttaccagattttaaccagatt
tgtagtaacatgcgctggactcgtgactga

DBGET integrated database retrieval system