KEGG   Rattus norvegicus (rat): 64200
Entry
64200             CDS       T01003                                 

Gene name
Hnrnpf, Hnrpf
Definition
(RefSeq) heterogeneous nuclear ribonucleoprotein F
  KO
K12898  heterogeneous nuclear ribonucleoprotein F/H
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    64200 (Hnrnpf)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   HnRNP proteins
    64200 (Hnrnpf)
SSDB
Motif
Pfam: RRM_1 zf-RNPHF
Other DBs
NCBI-GeneID: 64200
NCBI-ProteinID: NP_001032362
RGD: 620366
Ensembl: ENSRNOG00000014562
UniProt: Q794E4
Position
4q42
AA seq 415 aa
MMLGPEGGEGYVVKLRGLPWSCSIEDVQNFLSDCTIHDGVAGVHFIYTREGRQSGEAFVE
LESEDDVKLALKKDRESMGHRYIEVFKSHRTEMDWVLKHSGPNSADSANDGFVRLRGLPF
GCTKEEIVQFFSGLEIVPNGITLPVDPEGKITGEAFVQFASQELAEKALGKHKERIGHRY
IEVFKSSQEEVRSYSDPPLKFMSVQRPGPYDRPGTARRYIGIVKQAGLDRMRSGAYSAGY
GGYEEYSGLSDGYGFTTDLFGRDLSYCLSGMYDHRYGDSEFTVQSTTGHCVHMRGLPYKA
TENDIYNFFSPLNPVRVHIEIGPDGRVTGEADVEFATHEEAVAAMSKDRANMQHRYIELF
LNSTTGASNGAYSSQVMQGMGVSAAQATYSGLESQSVSGCYGAGYSGQNSMGGYD
NT seq 1248 nt   +upstreamnt  +downstreamnt
atgatgctgggccctgagggaggtgaaggctatgtggtcaaactccgtggcctaccctgg
tcctgctcaattgaggacgtacaaaacttcctctccgactgcacaattcatgatggggtc
gcaggtgttcatttcatttatactagagaaggcaggcagagtggtgaggcttttgttgaa
cttgagtcagaagatgatgtaaaattggctctgaaaaaagacagggaaagcatgggacac
cggtatattgaggtgttcaagtcacacagaaccgagatggattgggtgttgaagcacagt
ggtccaaacagcgccgacagtgccaatgatggctttgtgaggcttcggggactcccgttt
ggatgcacaaaggaagaaatcgttcagttcttctcagggttggaaattgtgccaaacggg
atcacactacctgtggacccggaaggcaagattacaggggaggccttcgttcagtttgcc
tcacaagagttagccgagaaagctttagggaagcacaaggagagaatagggcacaggtat
attgaagtgttcaagagcagtcaggaggaagttaggtcatactcagatccacctctgaag
tttatgtctgtgcagaggcctgggccttatgacaggcctggcacagcccggaggtacatt
ggcattgtgaaacaggcaggcctggataggatgaggtctggtgcctatagtgcaggctat
gggggctatgaagaatacagtggcctcagtgatggctatggcttcaccactgacctgttt
gggagagacctcagctattgtctctcaggaatgtatgatcacagatacggagacagcgag
ttcacagtgcagagcaccaccggccactgcgtccacatgagagggctgccctacaaagca
acggagaacgacatttacaacttcttctctccactcaaccctgtgagagttcatattgag
attggtcctgatggaagagtgaccggagaagctgatgttgagtttgctactcatgaagaa
gcagtggcagctatgtccaaggacagggccaacatgcagcacagatacatagaactcttc
ctgaattcaacaacaggagctagcaatggggcttatagcagccaggtgatgcagggcatg
ggtgtgtcagctgcccaggcaacttacagtggcctggagagccagtcagtgagtggctgt
tacggggccggctacagcggtcagaacagcatgggtggatatgattag

DBGET integrated database retrieval system