KEGG   Rattus norvegicus (rat): 64201
Entry
64201             CDS       T01003                                 

Gene name
Slc25a11
Definition
(RefSeq) solute carrier family 25 member 11
  KO
K15104  solute carrier family 25 (mitochondrial oxoglutarate transporter), member 11
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    64201 (Slc25a11)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   64201 (Slc25a11)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 64201
NCBI-ProteinID: NP_071793
RGD: 708476
Ensembl: ENSRNOG00000003815
UniProt: P97700
Position
10q24
AA seq 314 aa
MAATASPGAGRMDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVXNRMQLSGEGAKTRE
YKTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFL
LKALIGMTAGATGAFVGPPAEVALIRMTADGRLPADQRRGYKNVFNALIRIAREEGVPTL
WRGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCAIMISGLVTTAASMPV
DIVKTRIQNMRMIDEKPEYKNGLDVLLKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFL
EQMNKAYKRLFLSG
NT seq 945 nt   +upstreamnt  +downstreamnt
atggcggcgacggcgagtcccggggctggccggatggacgggaaaccccgtacctcccct
aagtctgtcaagttcctgtttgggggcctggctgggatgggcgctaccgtttttgtgcag
cccctggacctggtgaanaaccggatgcagttgagtggtgagggcgctaagactcgagag
tacaaaaccagtttccatgccctcactagcatcctgaaggcagaagggctgaggggcatt
tacactgggttgtcagccggcctactgcgccaggccacctacaccactacacgtcttggt
atatatacagtgttgtttgagcgcctgactggggctgacggtacaccccctggctttctc
ctgaaagccctgattggcatgactgcaggtgcaactggtgcatttgtgggaccaccagct
gaggtggccctcatcaggatgactgctgatggccggcttccagctgaccagcgccgtggc
tacaaaaatgtgtttaatgccctaattagaattgcaagggaagaaggagtccccacactg
tggcggggctgcatccctaccatggctcgagctgttgtcgtcaatgctgcccaacttgct
tcttactcccaatccaagcaattcttgctggactcaggctacttctctgacaacattctg
tgccacttctgcgccatcatgatcagtggcctggtcaccactgctgcttccatgcctgtg
gatattgtcaaaactaggatccaaaatatgcgaatgattgatgagaagccagagtacaag
aatgggctggatgtattgctgaaagtcgtccgctatgagggtttcttcagcctgtggaag
ggcttcacaccatactatgcccgactgggcccccacactgtcctcaccttcatcttcttg
gaacagatgaacaaggcctacaagcgtctcttcctcagtggctga

DBGET integrated database retrieval system