KEGG   Rattus norvegicus (rat): 64202Help
Entry
64202             CDS       T01003                                 

Gene name
Calr
Definition
(RefSeq) calreticulin
  KO
K08057  calreticulin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04141  Protein processing in endoplasmic reticulum
rno04145  Phagosome
rno04612  Antigen processing and presentation
rno05142  Chagas disease (American trypanosomiasis)
rno05163  Human cytomegalovirus infection
rno05166  Human T-cell leukemia virus 1 infection
rno05168  Herpes simplex virus 1 infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    64202 (Calr)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    64202 (Calr)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    64202 (Calr)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    64202 (Calr)
   05170 Human immunodeficiency virus 1 infection
    64202 (Calr)
   05168 Herpes simplex virus 1 infection
    64202 (Calr)
   05163 Human cytomegalovirus infection
    64202 (Calr)
   05169 Epstein-Barr virus infection
    64202 (Calr)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    64202 (Calr)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    64202 (Calr)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:rno04091]
    64202 (Calr)
Chaperones and folding catalysts [BR:rno03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   64202 (Calr)
Lectins [BR:rno04091]
 Calnexin / calreticulin
  64202 (Calr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Calreticulin MDM10 Astro_capsid_p
Motif
Other DBs
NCBI-GeneID: 64202
NCBI-ProteinID: NP_071794
RGD: 620288
Ensembl: ENSRNOG00000003029
UniProt: P18418
Structure
PDB: 

Position
19q11
AA seq 416 aa AA seqDB search
MLLSVPLLLGLLGLAAADPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDQ
EKDKGLQTSQDARFYALSARFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPGGLDQK
DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN
TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPE
HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS
PDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDK
QDEEQRLKEEEEDKKRKEEEEAEDKEDEDDRDEDEDEEDEKEEDEEDATGQAKDEL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgctcctttcggtgccgctcctgcttggcctcctcggcctggctgccgcagaccctgcc
atctatttcaaagagcagttcttggacggagatgcctggaccaaccgctgggtcgaatcc
aaacataagtctgattttggcaaattcgtcctcagttctggcaaattctacggggaccag
gagaaggataaagggttgcagacaagccaagatgcccgattttacgcgctgtccgccaga
ttcgaacccttcagcaacaagggccagacactggtggtacagttcaccgtgaagcatgag
cagaatatcgactgtgggggcggctacgtgaagctgtttccgggtggcttggaccagaag
gacatgcatggagactcagaatataacatcatgtttggtccggacatctgcggtcctggc
accaagaaggttcatgtcatctttaactacaagggcaagaacgtgctgatcaacaaggat
atccggtgtaaggatgatgaattcacacatctatacacgctgattgtgcggccagacaac
acctacgaggtgaaaattgacaacagccaggtggagtcgggctccttggaggatgattgg
gactttctgccgcccaagaagattaaggatcctgacgctgccaagccagaagactgggat
gaacgagccaagattgatgaccccacagattccaagcctgaggactgggacaagccagag
cacatccctgaccctgatgctaagaagcctgaggactgggacgaagagatggatggagag
tgggaaccaccagtgattcaaaatcctgaatacaagggcgaatggaagccacgtcaaatt
gacaacccagattacaagggtacctggatacacccagagattgacaatcctgaatactcc
cccgatgcgaatatctatgcctatgatagttttgctgtactgggcttagacctctggcag
gtcaagtctggcacaatttttgacaacttcctcatcaccaatgatgaggcctatgcagag
gagtttggcaatgagacctggggtgtcaccaaggctgcagagaagcagatgaaggacaag
caggatgaggagcagaggcttaaggaagaagaagaagacaagaagcgtaaagaggaagag
gaggccgaggataaagaggatgaggatgacagagatgaagatgaagatgaagaggatgag
aaggaagaagatgaggaggatgccactggccaagccaaggatgagctgtag

DBGET integrated database retrieval system